
Grilla Burn Bullets Twin Pack
{"id":8782638985,"title":"Grilla Burn Bullets Twin Pack","handle":"grilla-burn-bullets-twin-pack","description":"\u003c!-- Created with Shogun. --\u003e\n\n\u003cdiv class=\"shogun-root\" data-shogun-id=\"5a514163fb3d4900444cec03\" data-shogun-site-id=\"594a632b-8f27-4fa6-bc19-96f7d437e854\" data-shogun-page-id=\"5a514163fb3d4900444cec03\" data-shogun-page-version-id=\"5d556d00b4182e0052dd4249\" data-shogun-platform-type=\"shopify\" data-shogun-variant-id=\"5d556d01b4182e0052dd44a1\" data-region=\"main\"\u003e\n \n\n\u003cdiv id=\"s-d6ff599e-bf01-47fb-afb4-b5ce43cc49d2\" class=\"shg-c \"\u003e\n \u003cdiv class=\"shg-rich-text shg-theme-text-content\"\u003e\u003cp\u003e\u003cspan class=\"s1\" style=\"font-family: Avenir;\"\u003eFire up your metabolism with Grilla Burn Bullets. With thousands of happy customers who have experienced amazing body transformations, Burn Bullets boost your metabolism to ensure it is firing right to aid your weight loss. With added green tea and caffeine, the Burn Bullets also help boost concentration, alertness, and energy whilst working out.\u003c\/span\u003e\u003c\/p\u003e\u003c\/div\u003e\n\n\u003c\/div\u003e\n\n\u003cdiv id=\"s-a25ddaed-10ba-4c73-81ca-b9a830eb9550\" class=\"shg-c \"\u003e\n \u003cdiv class=\"GFproduct-swatches GFproduct-swatches-1234\"\u003e\n \u003cmeta http-equiv=\"Cache-control\" content=\"public\"\u003e\n\n \u003cdiv\u003e\u003c\/div\u003e\n \u003cul class=\"GFproduct-swatches-ul\"\u003e\n \n \u003c\/ul\u003e\n\n \u003cdiv style=\"clear:both;\"\u003e\u003c\/div\u003e\n\n\u003c\/div\u003e\n\u003c\/div\u003e\n\n\n\u003c\/div\u003e\n","published_at":"2017-01-31T14:40:00+00:00","created_at":"2017-01-31T14:41:04+00:00","vendor":"Grilla Fitness","type":"SUPPLEMENTS","tags":["Fat Burners and Weight Loss","Grilla","Shop By Brand G - L","Shop By Category A - G","top 5 Fat Burning Pills","Top 5 Lean Protein Powders","Weight Loss"],"price":5399,"price_min":5399,"price_max":5399,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":30067757897,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"GrillaBBB2","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Grilla Burn Bullets Twin Pack","public_title":null,"options":["Default Title"],"price":5399,"weight":140,"compare_at_price":null,"inventory_quantity":2329,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090789"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/BurnBullets2n.png?v=1564597866"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/BurnBullets2n.png?v=1564597866","options":["Title"],"content":"\u003c!-- Created with Shogun. --\u003e\n\n\u003cdiv class=\"shogun-root\" data-shogun-id=\"5a514163fb3d4900444cec03\" data-shogun-site-id=\"594a632b-8f27-4fa6-bc19-96f7d437e854\" data-shogun-page-id=\"5a514163fb3d4900444cec03\" data-shogun-page-version-id=\"5d556d00b4182e0052dd4249\" data-shogun-platform-type=\"shopify\" data-shogun-variant-id=\"5d556d01b4182e0052dd44a1\" data-region=\"main\"\u003e\n \n\n\u003cdiv id=\"s-d6ff599e-bf01-47fb-afb4-b5ce43cc49d2\" class=\"shg-c \"\u003e\n \u003cdiv class=\"shg-rich-text shg-theme-text-content\"\u003e\u003cp\u003e\u003cspan class=\"s1\" style=\"font-family: Avenir;\"\u003eFire up your metabolism with Grilla Burn Bullets. With thousands of happy customers who have experienced amazing body transformations, Burn Bullets boost your metabolism to ensure it is firing right to aid your weight loss. With added green tea and caffeine, the Burn Bullets also help boost concentration, alertness, and energy whilst working out.\u003c\/span\u003e\u003c\/p\u003e\u003c\/div\u003e\n\n\u003c\/div\u003e\n\n\u003cdiv id=\"s-a25ddaed-10ba-4c73-81ca-b9a830eb9550\" class=\"shg-c \"\u003e\n \u003cdiv class=\"GFproduct-swatches GFproduct-swatches-1234\"\u003e\n \u003cmeta http-equiv=\"Cache-control\" content=\"public\"\u003e\n\n \u003cdiv\u003e\u003c\/div\u003e\n \u003cul class=\"GFproduct-swatches-ul\"\u003e\n \n \u003c\/ul\u003e\n\n \u003cdiv style=\"clear:both;\"\u003e\u003c\/div\u003e\n\n\u003c\/div\u003e\n\u003c\/div\u003e\n\n\n\u003c\/div\u003e\n"}

Grilla Burn Bullets Twin Pack

Fire up your metabolism with Grilla Burn Bullets. With thousands of happy customers who have experienced amazing body transformations, Burn Bullets boost your metabolism to ensure it is firing right to aid your weight loss. With added green tea and caffeine, the Burn Bullets also help boost concentration, alertness, and...
Sale 50% off
Grilla Cobra Breathable Vest Grilla Cobra Breathable Vest
{"id":8782651785,"title":"Grilla Cobra Breathable Vest","handle":"grilla-cobra-breathable-vest-black","description":"The Grilla Cobra breathable Tank is part of our launch collection. This Tank uses a high quality performance material which is fitted yet allows freedom of movement. It includes a breathable mesh panel on the back which is visually striking as well as cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e 92% Polyester 8% Elastane \u003cbr\u003e Model is 6,4 and wears large","published_at":"2017-01-31T14:43:00+00:00","created_at":"2017-01-31T14:43:19+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":700,"price_min":700,"price_max":700,"available":true,"price_varies":false,"compare_at_price":1400,"compare_at_price_min":1400,"compare_at_price_max":1400,"compare_at_price_varies":false,"variants":[{"id":30067843657,"title":"S","option1":"S","option2":null,"option3":null,"sku":"CobraBS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353361545,"product_id":8782651785,"position":1,"created_at":"2017-01-31T14:43:19+00:00","updated_at":"2017-01-31T14:43:19+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestblackfront.jpg?v=1485873799","variant_ids":[30067843657,30067843721,30067843785,30067843849]},"available":true,"name":"Grilla Cobra Breathable Vest - S","public_title":"S","options":["S"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":17,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090703"},{"id":30067843721,"title":"M","option1":"M","option2":null,"option3":null,"sku":"CobraBM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353361545,"product_id":8782651785,"position":1,"created_at":"2017-01-31T14:43:19+00:00","updated_at":"2017-01-31T14:43:19+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestblackfront.jpg?v=1485873799","variant_ids":[30067843657,30067843721,30067843785,30067843849]},"available":true,"name":"Grilla Cobra Breathable Vest - M","public_title":"M","options":["M"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":27,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090710"},{"id":30067843785,"title":"L","option1":"L","option2":null,"option3":null,"sku":"CobraBL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353361545,"product_id":8782651785,"position":1,"created_at":"2017-01-31T14:43:19+00:00","updated_at":"2017-01-31T14:43:19+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestblackfront.jpg?v=1485873799","variant_ids":[30067843657,30067843721,30067843785,30067843849]},"available":true,"name":"Grilla Cobra Breathable Vest - L","public_title":"L","options":["L"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":26,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090727"},{"id":30067843849,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"CobraBXL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353361545,"product_id":8782651785,"position":1,"created_at":"2017-01-31T14:43:19+00:00","updated_at":"2017-01-31T14:43:19+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestblackfront.jpg?v=1485873799","variant_ids":[30067843657,30067843721,30067843785,30067843849]},"available":true,"name":"Grilla Cobra Breathable Vest - XL","public_title":"XL","options":["XL"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":32,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090734"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestblackfront.jpg?v=1485873799","\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestblackback.jpg?v=1485873799","\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestblackfrontdetail.jpg?v=1485873799","\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestblackbackdetail.jpg?v=1485873799"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestblackfront.jpg?v=1485873799","options":["size"],"content":"The Grilla Cobra breathable Tank is part of our launch collection. This Tank uses a high quality performance material which is fitted yet allows freedom of movement. It includes a breathable mesh panel on the back which is visually striking as well as cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e 92% Polyester 8% Elastane \u003cbr\u003e Model is 6,4 and wears large"}

Grilla Cobra Breathable Vest

£7.00 £14.00

Grilla Cobra Breathable Vest

£7.00 £14.00
The Grilla Cobra breathable Tank is part of our launch collection. This Tank uses a high quality performance material which is fitted yet allows freedom of movement. It includes a breathable mesh panel on the back which is visually striking as well as cooling, promoting increased performance. Key notes Striking...
Sale 50% off
Grilla Cobra Breathable Vest Grilla Cobra Breathable Vest
{"id":8782652489,"title":"Grilla Cobra Breathable Vest","handle":"grilla-cobra-breathable-vest-white","description":"The Grilla Cobra breathable Tank is part of our launch collection. This Tank uses a high quality performance material which is fitted yet allows freedom of movement. It includes a breathable mesh panel on the back which is visually striking as well as cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e 92% Polyester 8% Elastane \u003cbr\u003e Model is 5,11 and wears medium","published_at":"2017-01-31T14:43:00+00:00","created_at":"2017-01-31T14:43:29+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":700,"price_min":700,"price_max":700,"available":true,"price_varies":false,"compare_at_price":1400,"compare_at_price_min":1400,"compare_at_price_max":1400,"compare_at_price_varies":false,"variants":[{"id":30067851785,"title":"S","option1":"S","option2":null,"option3":null,"sku":"CobraWS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353363401,"product_id":8782652489,"position":1,"created_at":"2017-01-31T14:43:29+00:00","updated_at":"2017-01-31T14:43:29+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestwhitefront.jpg?v=1485873809","variant_ids":[30067851785,30067851849,30067851913,30067851977]},"available":true,"name":"Grilla Cobra Breathable Vest - S","public_title":"S","options":["S"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":40,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090666"},{"id":30067851849,"title":"M","option1":"M","option2":null,"option3":null,"sku":"CobraWM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353363401,"product_id":8782652489,"position":1,"created_at":"2017-01-31T14:43:29+00:00","updated_at":"2017-01-31T14:43:29+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestwhitefront.jpg?v=1485873809","variant_ids":[30067851785,30067851849,30067851913,30067851977]},"available":true,"name":"Grilla Cobra Breathable Vest - M","public_title":"M","options":["M"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":28,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090673"},{"id":30067851977,"title":"L","option1":"L","option2":null,"option3":null,"sku":"CobraWL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353363401,"product_id":8782652489,"position":1,"created_at":"2017-01-31T14:43:29+00:00","updated_at":"2017-01-31T14:43:29+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestwhitefront.jpg?v=1485873809","variant_ids":[30067851785,30067851849,30067851913,30067851977]},"available":true,"name":"Grilla Cobra Breathable Vest - L","public_title":"L","options":["L"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":28,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090697"},{"id":30067851913,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"CobraWXL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353363401,"product_id":8782652489,"position":1,"created_at":"2017-01-31T14:43:29+00:00","updated_at":"2017-01-31T14:43:29+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestwhitefront.jpg?v=1485873809","variant_ids":[30067851785,30067851849,30067851913,30067851977]},"available":true,"name":"Grilla Cobra Breathable Vest - XL","public_title":"XL","options":["XL"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":20,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090680"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestwhitefront.jpg?v=1485873809","\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestwhiteback.jpg?v=1485873809","\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestwhitefrontdetail.jpg?v=1485873809","\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestwhitebackdetail.jpg?v=1485873809"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestwhitefront.jpg?v=1485873809","options":["size"],"content":"The Grilla Cobra breathable Tank is part of our launch collection. This Tank uses a high quality performance material which is fitted yet allows freedom of movement. It includes a breathable mesh panel on the back which is visually striking as well as cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e 92% Polyester 8% Elastane \u003cbr\u003e Model is 5,11 and wears medium"}

Grilla Cobra Breathable Vest

£7.00 £14.00

Grilla Cobra Breathable Vest

£7.00 £14.00
The Grilla Cobra breathable Tank is part of our launch collection. This Tank uses a high quality performance material which is fitted yet allows freedom of movement. It includes a breathable mesh panel on the back which is visually striking as well as cooling, promoting increased performance. Key notes Striking...
Protein Shaker Black
{"id":8782650313,"title":"Grilla Fitness Protein Shaker","handle":"grilla-fitness-protein-shaker-black","description":"\u003cp\u003eOur shaker bottle with plastic mixing mesh allows you to mix your protein drinks easily and quickly. At 600ml there are no blenders needed, just add protein powder, add water or milk and shake.\u003c\/p\u003e\n\u003cp\u003eREMEMBER to post your #SHAKERSELFIE @grillafitness to appear on our social media\u003c\/p\u003e","published_at":"2017-01-31T14:43:00+00:00","created_at":"2017-01-31T14:43:08+00:00","vendor":"Grilla Fitness","type":"ACCESSORIES","tags":[],"price":299,"price_min":299,"price_max":299,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":30067834761,"title":"Default","option1":"Default","option2":null,"option3":null,"sku":"GrillaSHBLA","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Grilla Fitness Protein Shaker","public_title":null,"options":["Default"],"price":299,"weight":120,"compare_at_price":null,"inventory_quantity":231,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090758"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillashaker600mlblack.jpg?v=1485873789"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillashaker600mlblack.jpg?v=1485873789","options":["Title"],"content":"\u003cp\u003eOur shaker bottle with plastic mixing mesh allows you to mix your protein drinks easily and quickly. At 600ml there are no blenders needed, just add protein powder, add water or milk and shake.\u003c\/p\u003e\n\u003cp\u003eREMEMBER to post your #SHAKERSELFIE @grillafitness to appear on our social media\u003c\/p\u003e"}

Grilla Fitness Protein Shaker

Our shaker bottle with plastic mixing mesh allows you to mix your protein drinks easily and quickly. At 600ml there are no blenders needed, just add protein powder, add water or milk and shake. REMEMBER to post your #SHAKERSELFIE @grillafitness to appear on our social media
Protein Shaker Blue
{"id":8782650889,"title":"Grilla Fitness Protein Shaker","handle":"grilla-fitness-protein-shaker-blue","description":"\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003eOur shaker bottle with plastic mixing mesh allows you to mix your protein drinks easily and quickly. At 600ml there are no blenders needed, just add protein powder, add water or milk and shake.\u003c\/p\u003e\n\u003cp\u003eREMEMBER to post your #SHAKERSELFIE @grillafitness to appear on our social media\u003c\/p\u003e","published_at":"2017-01-31T14:43:00+00:00","created_at":"2017-01-31T14:43:12+00:00","vendor":"Grilla Fitness","type":"ACCESSORIES","tags":[],"price":299,"price_min":299,"price_max":299,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":30067835401,"title":"Default","option1":"Default","option2":null,"option3":null,"sku":"GrillaSHBLU","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Grilla Fitness Protein Shaker","public_title":null,"options":["Default"],"price":299,"weight":120,"compare_at_price":null,"inventory_quantity":330,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090741"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillashaker600mlblue.jpg?v=1485873792"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillashaker600mlblue.jpg?v=1485873792","options":["Title"],"content":"\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003eOur shaker bottle with plastic mixing mesh allows you to mix your protein drinks easily and quickly. At 600ml there are no blenders needed, just add protein powder, add water or milk and shake.\u003c\/p\u003e\n\u003cp\u003eREMEMBER to post your #SHAKERSELFIE @grillafitness to appear on our social media\u003c\/p\u003e"}

Grilla Fitness Protein Shaker

Our shaker bottle with plastic mixing mesh allows you to mix your protein drinks easily and quickly. At 600ml there are no blenders needed, just add protein powder, add water or milk and shake. REMEMBER to post your #SHAKERSELFIE @grillafitness to appear on our social media
Sale 50% off
Grilla Freeflow Breathable Crew Grilla Freeflow Breathable Crew
{"id":8782653449,"title":"Grilla Freeflow Breathable Crew","handle":"grilla-freeflow-breathable-crew-grey","description":"The Grilla Freeflow breathable Crew is part of our launch collection. The Freeflow uses a high quality performance material which provides compression yet allows freedom for explosive movement when called upon. It includes breathable mesh panelling on the back which is arranged to the contours of the back muscles to give a physique enhancing result. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e Compression feel\u003cbr\u003e \u003cbr\u003e Model is 5,11 and wears medium","published_at":"2017-01-31T14:43:00+00:00","created_at":"2017-01-31T14:43:38+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":1000,"price_min":1000,"price_max":1000,"available":true,"price_varies":false,"compare_at_price":2000,"compare_at_price_min":2000,"compare_at_price_max":2000,"compare_at_price_varies":false,"variants":[{"id":30067859529,"title":"S","option1":"S","option2":null,"option3":null,"sku":"FreeflowGS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353365961,"product_id":8782653449,"position":1,"created_at":"2017-01-31T14:43:38+00:00","updated_at":"2017-01-31T14:43:38+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewfront.jpg?v=1485873818","variant_ids":[30067859529,30067859593,30067859657,30067859721]},"available":true,"name":"Grilla Freeflow Breathable Crew - S","public_title":"S","options":["S"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":350,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090628"},{"id":30067859593,"title":"M","option1":"M","option2":null,"option3":null,"sku":"FreeflowGM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353365961,"product_id":8782653449,"position":1,"created_at":"2017-01-31T14:43:38+00:00","updated_at":"2017-01-31T14:43:38+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewfront.jpg?v=1485873818","variant_ids":[30067859529,30067859593,30067859657,30067859721]},"available":true,"name":"Grilla Freeflow Breathable Crew - M","public_title":"M","options":["M"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":373,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090635"},{"id":30067859657,"title":"L","option1":"L","option2":null,"option3":null,"sku":"FreeflowGL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353365961,"product_id":8782653449,"position":1,"created_at":"2017-01-31T14:43:38+00:00","updated_at":"2017-01-31T14:43:38+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewfront.jpg?v=1485873818","variant_ids":[30067859529,30067859593,30067859657,30067859721]},"available":true,"name":"Grilla Freeflow Breathable Crew - L","public_title":"L","options":["L"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":278,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090642"},{"id":30067859721,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"FreeflowGXL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353365961,"product_id":8782653449,"position":1,"created_at":"2017-01-31T14:43:38+00:00","updated_at":"2017-01-31T14:43:38+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewfront.jpg?v=1485873818","variant_ids":[30067859529,30067859593,30067859657,30067859721]},"available":true,"name":"Grilla Freeflow Breathable Crew - XL","public_title":"XL","options":["XL"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":142,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090659"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewfront.jpg?v=1485873818","\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewback.jpg?v=1485873818"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewfront.jpg?v=1485873818","options":["size"],"content":"The Grilla Freeflow breathable Crew is part of our launch collection. The Freeflow uses a high quality performance material which provides compression yet allows freedom for explosive movement when called upon. It includes breathable mesh panelling on the back which is arranged to the contours of the back muscles to give a physique enhancing result. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e Compression feel\u003cbr\u003e \u003cbr\u003e Model is 5,11 and wears medium"}

Grilla Freeflow Breathable Crew

£10.00 £20.00

Grilla Freeflow Breathable Crew

£10.00 £20.00
The Grilla Freeflow breathable Crew is part of our launch collection. The Freeflow uses a high quality performance material which provides compression yet allows freedom for explosive movement when called upon. It includes breathable mesh panelling on the back which is arranged to the contours of the back muscles to...
Sale 50% off
Grilla Freeflow Breathable Crew
{"id":8782653897,"title":"Grilla Freeflow Breathable Crew","handle":"grilla-freeflow-breathable-crew-blue","description":"The Grilla Freeflow breathable Crew is part of our launch collection. The Freeflow uses a high quality performance material which provides compression yet allows freedom for explosive movement when called upon. It includes breathable mesh panelling on the back which is arranged to the contours of the back muscles to give a physique enhancing result. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e Compression feel\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears large","published_at":"2017-01-31T14:43:00+00:00","created_at":"2017-01-31T14:43:43+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":1000,"price_min":1000,"price_max":1000,"available":true,"price_varies":false,"compare_at_price":2000,"compare_at_price_min":2000,"compare_at_price_max":2000,"compare_at_price_varies":false,"variants":[{"id":30067860297,"title":"S","option1":"S","option2":null,"option3":null,"sku":"FreeflowBS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353367881,"product_id":8782653897,"position":1,"created_at":"2017-01-31T14:43:43+00:00","updated_at":"2017-01-31T14:43:43+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewbluefront.jpg?v=1485873823","variant_ids":[30067860297,30067860361,30067860425,30067860489]},"available":true,"name":"Grilla Freeflow Breathable Crew - S","public_title":"S","options":["S"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":77,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090581"},{"id":30067860361,"title":"M","option1":"M","option2":null,"option3":null,"sku":"FreeflowBM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353367881,"product_id":8782653897,"position":1,"created_at":"2017-01-31T14:43:43+00:00","updated_at":"2017-01-31T14:43:43+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewbluefront.jpg?v=1485873823","variant_ids":[30067860297,30067860361,30067860425,30067860489]},"available":true,"name":"Grilla Freeflow Breathable Crew - M","public_title":"M","options":["M"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":61,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090598"},{"id":30067860489,"title":"L","option1":"L","option2":null,"option3":null,"sku":"FreeflowBL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353367881,"product_id":8782653897,"position":1,"created_at":"2017-01-31T14:43:43+00:00","updated_at":"2017-01-31T14:43:43+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewbluefront.jpg?v=1485873823","variant_ids":[30067860297,30067860361,30067860425,30067860489]},"available":true,"name":"Grilla Freeflow Breathable Crew - L","public_title":"L","options":["L"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":51,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090611"},{"id":30067860425,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"FreeflowBXL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353367881,"product_id":8782653897,"position":1,"created_at":"2017-01-31T14:43:43+00:00","updated_at":"2017-01-31T14:43:43+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewbluefront.jpg?v=1485873823","variant_ids":[30067860297,30067860361,30067860425,30067860489]},"available":true,"name":"Grilla Freeflow Breathable Crew - XL","public_title":"XL","options":["XL"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":66,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090598"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewbluefront.jpg?v=1485873823"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewbluefront.jpg?v=1485873823","options":["size"],"content":"The Grilla Freeflow breathable Crew is part of our launch collection. The Freeflow uses a high quality performance material which provides compression yet allows freedom for explosive movement when called upon. It includes breathable mesh panelling on the back which is arranged to the contours of the back muscles to give a physique enhancing result. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e Compression feel\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears large"}

Grilla Freeflow Breathable Crew

£10.00 £20.00

Grilla Freeflow Breathable Crew

£10.00 £20.00
The Grilla Freeflow breathable Crew is part of our launch collection. The Freeflow uses a high quality performance material which provides compression yet allows freedom for explosive movement when called upon. It includes breathable mesh panelling on the back which is arranged to the contours of the back muscles to...
Sale 50% off
Grilla FreeStyle Breathable Vest Grilla FreeStyle Breathable Vest
{"id":8782654921,"title":"Grilla FreeStyle Breathable Vest","handle":"grilla-freestyle-breathable-vest-blue","description":"\u003cp\u003eThe Grilla FreeStyle breathable vest is part of our launch collection. The FreeStyle uses a high quality lightweight performance material which provides support yet figure flattering styling. It feels great to the touch, including breathable mesh panelling on the front and back which is arranged to the contours of the body. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Figure enhancing fit\u003cbr\u003e Light Weight yet high quality fabric\u003cbr\u003e Shell: 92% Polyester 8% Elastane \u003cbr\u003e Panel: 92% Polyester 8% Elastane \u003cbr\u003e \u003cbr\u003e Model is 5,6 and wears small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e","published_at":"2017-01-31T14:43:00+00:00","created_at":"2017-01-31T14:43:53+00:00","vendor":"Grilla Clothing","type":"WOMENS","tags":[],"price":700,"price_min":700,"price_max":700,"available":true,"price_varies":false,"compare_at_price":1400,"compare_at_price_min":1400,"compare_at_price_max":1400,"compare_at_price_varies":false,"variants":[{"id":30067865353,"title":"S","option1":"S","option2":null,"option3":null,"sku":"FreeStyleBS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353370185,"product_id":8782654921,"position":1,"created_at":"2017-01-31T14:43:53+00:00","updated_at":"2017-01-31T14:43:53+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestbluefront.jpg?v=1485873833","variant_ids":[30067865353,30067865481,30067865545]},"available":true,"name":"Grilla FreeStyle Breathable Vest - S","public_title":"S","options":["S"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":82,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090550"},{"id":30067865481,"title":"M","option1":"M","option2":null,"option3":null,"sku":"FreeStyleBM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353370185,"product_id":8782654921,"position":1,"created_at":"2017-01-31T14:43:53+00:00","updated_at":"2017-01-31T14:43:53+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestbluefront.jpg?v=1485873833","variant_ids":[30067865353,30067865481,30067865545]},"available":true,"name":"Grilla FreeStyle Breathable Vest - M","public_title":"M","options":["M"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":86,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090567"},{"id":30067865545,"title":"L","option1":"L","option2":null,"option3":null,"sku":"FreeStyleBL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353370185,"product_id":8782654921,"position":1,"created_at":"2017-01-31T14:43:53+00:00","updated_at":"2017-01-31T14:43:53+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestbluefront.jpg?v=1485873833","variant_ids":[30067865353,30067865481,30067865545]},"available":true,"name":"Grilla FreeStyle Breathable Vest - L","public_title":"L","options":["L"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":85,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090574"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestbluefront.jpg?v=1485873833","\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestblueback.jpg?v=1485873833"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestbluefront.jpg?v=1485873833","options":["size"],"content":"\u003cp\u003eThe Grilla FreeStyle breathable vest is part of our launch collection. The FreeStyle uses a high quality lightweight performance material which provides support yet figure flattering styling. It feels great to the touch, including breathable mesh panelling on the front and back which is arranged to the contours of the body. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Figure enhancing fit\u003cbr\u003e Light Weight yet high quality fabric\u003cbr\u003e Shell: 92% Polyester 8% Elastane \u003cbr\u003e Panel: 92% Polyester 8% Elastane \u003cbr\u003e \u003cbr\u003e Model is 5,6 and wears small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e"}

Grilla FreeStyle Breathable Vest

£7.00 £14.00

Grilla FreeStyle Breathable Vest

£7.00 £14.00
The Grilla FreeStyle breathable vest is part of our launch collection. The FreeStyle uses a high quality lightweight performance material which provides support yet figure flattering styling. It feels great to the touch, including breathable mesh panelling on the front and back which is arranged to the contours of the...
Sale 50% off
Grilla FreeStyle Breathable Vest Grilla FreeStyle Breathable Vest
{"id":8782655433,"title":"Grilla FreeStyle Breathable Vest","handle":"grilla-freestyle-breathable-vest-pink","description":"\u003cp\u003eThe Grilla FreeStyle breathable vest is part of our launch collection. The FreeStyle uses a high quality lightweight performance material which provides support yet figure flattering styling. It feels great to the touch, including breathable mesh panelling on the front and back which is arranged to the contours of the body. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Figure enhancing fit\u003cbr\u003e Light Weight yet high quality fabric\u003cbr\u003e Shell: 92% Polyester 8% Elastane \u003cbr\u003e Panel: 92% Polyester 8% Elastane\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eModel is 5,6 and wears small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e","published_at":"2017-01-31T14:43:00+00:00","created_at":"2017-01-31T14:44:01+00:00","vendor":"Grilla Clothing","type":"WOMENS","tags":[],"price":700,"price_min":700,"price_max":700,"available":true,"price_varies":false,"compare_at_price":1400,"compare_at_price_min":1400,"compare_at_price_max":1400,"compare_at_price_varies":false,"variants":[{"id":30067867209,"title":"S","option1":"S","option2":null,"option3":null,"sku":"FreeStylePS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353371977,"product_id":8782655433,"position":1,"created_at":"2017-01-31T14:44:02+00:00","updated_at":"2017-01-31T14:44:02+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkfront.jpg?v=1485873842","variant_ids":[30067867209,30067867273,30067867337]},"available":true,"name":"Grilla FreeStyle Breathable Vest - S","public_title":"S","options":["S"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":68,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090529"},{"id":30067867273,"title":"M","option1":"M","option2":null,"option3":null,"sku":"FreeStylePM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353371977,"product_id":8782655433,"position":1,"created_at":"2017-01-31T14:44:02+00:00","updated_at":"2017-01-31T14:44:02+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkfront.jpg?v=1485873842","variant_ids":[30067867209,30067867273,30067867337]},"available":true,"name":"Grilla FreeStyle Breathable Vest - M","public_title":"M","options":["M"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":66,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090536"},{"id":30067867337,"title":"L","option1":"L","option2":null,"option3":null,"sku":"FreeStylePL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353371977,"product_id":8782655433,"position":1,"created_at":"2017-01-31T14:44:02+00:00","updated_at":"2017-01-31T14:44:02+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkfront.jpg?v=1485873842","variant_ids":[30067867209,30067867273,30067867337]},"available":true,"name":"Grilla FreeStyle Breathable Vest - L","public_title":"L","options":["L"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":70,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090543"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkfront.jpg?v=1485873842","\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkback.jpg?v=1485873842","\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkside.jpg?v=1485873842"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkfront.jpg?v=1485873842","options":["size"],"content":"\u003cp\u003eThe Grilla FreeStyle breathable vest is part of our launch collection. The FreeStyle uses a high quality lightweight performance material which provides support yet figure flattering styling. It feels great to the touch, including breathable mesh panelling on the front and back which is arranged to the contours of the body. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Figure enhancing fit\u003cbr\u003e Light Weight yet high quality fabric\u003cbr\u003e Shell: 92% Polyester 8% Elastane \u003cbr\u003e Panel: 92% Polyester 8% Elastane\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eModel is 5,6 and wears small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e"}

Grilla FreeStyle Breathable Vest

£7.00 £14.00

Grilla FreeStyle Breathable Vest

£7.00 £14.00
The Grilla FreeStyle breathable vest is part of our launch collection. The FreeStyle uses a high quality lightweight performance material which provides support yet figure flattering styling. It feels great to the touch, including breathable mesh panelling on the front and back which is arranged to the contours of the...
Sale 50% off
Grilla Pyro Leggings Grilla Pyro Leggings
{"id":8782662601,"title":"Grilla Pyro Leggings","handle":"grilla-pyro-leggings","description":"\u003cp\u003eOur Pryo Leggings are high waisted and very flattering. Make a big statement when you train by wearing these! Our eye catching pyro Leggings are for the bold fitness girls and are certain to gain you many complimentary comments. These high quality, flexible leggings will support you in all the right places. \u003cbr\u003e Key Notes\u003cbr\u003e Great fit\u003cbr\u003e High waisted\u003cbr\u003e Zip Pocket\u003cbr\u003e Body enhancing\u003cbr\u003e Great Design\u003cbr\u003e 92% Polyester 8% Elastane \u003cbr\u003e \u003cbr\u003e Model is 5,6 and wears size small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e","published_at":"2017-01-31T14:44:00+00:00","created_at":"2017-01-31T14:44:54+00:00","vendor":"Grilla Clothing","type":"WOMENS","tags":["Womens Gym Training Apparel"],"price":1000,"price_min":1000,"price_max":1000,"available":true,"price_varies":false,"compare_at_price":2000,"compare_at_price_min":2000,"compare_at_price_max":2000,"compare_at_price_varies":false,"variants":[{"id":30067915593,"title":"S","option1":"S","option2":null,"option3":null,"sku":"PyroS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353390665,"product_id":8782662601,"position":1,"created_at":"2017-01-31T14:44:54+00:00","updated_at":"2017-01-31T14:44:54+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfront.jpg?v=1485873894","variant_ids":[30067915593,30067915657,30067915721]},"available":true,"name":"Grilla Pyro Leggings - S","public_title":"S","options":["S"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":38,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090307"},{"id":30067915657,"title":"M","option1":"M","option2":null,"option3":null,"sku":"PyroM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353390665,"product_id":8782662601,"position":1,"created_at":"2017-01-31T14:44:54+00:00","updated_at":"2017-01-31T14:44:54+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfront.jpg?v=1485873894","variant_ids":[30067915593,30067915657,30067915721]},"available":true,"name":"Grilla Pyro Leggings - M","public_title":"M","options":["M"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":36,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090314"},{"id":30067915721,"title":"L","option1":"L","option2":null,"option3":null,"sku":"PyroL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353390665,"product_id":8782662601,"position":1,"created_at":"2017-01-31T14:44:54+00:00","updated_at":"2017-01-31T14:44:54+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfront.jpg?v=1485873894","variant_ids":[30067915593,30067915657,30067915721]},"available":true,"name":"Grilla Pyro Leggings - L","public_title":"L","options":["L"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":52,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090321"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfront.jpg?v=1485873894","\/\/\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkback.jpg?v=1485873894","\/\/\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfulllength.jpg?v=1485873894","\/\/\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfulllengthback.jpg?v=1485873894"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfront.jpg?v=1485873894","options":["size"],"content":"\u003cp\u003eOur Pryo Leggings are high waisted and very flattering. Make a big statement when you train by wearing these! Our eye catching pyro Leggings are for the bold fitness girls and are certain to gain you many complimentary comments. These high quality, flexible leggings will support you in all the right places. \u003cbr\u003e Key Notes\u003cbr\u003e Great fit\u003cbr\u003e High waisted\u003cbr\u003e Zip Pocket\u003cbr\u003e Body enhancing\u003cbr\u003e Great Design\u003cbr\u003e 92% Polyester 8% Elastane \u003cbr\u003e \u003cbr\u003e Model is 5,6 and wears size small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e"}

Grilla Pyro Leggings

£10.00 £20.00

Grilla Pyro Leggings

£10.00 £20.00
Our Pryo Leggings are high waisted and very flattering. Make a big statement when you train by wearing these! Our eye catching pyro Leggings are for the bold fitness girls and are certain to gain you many complimentary comments. These high quality, flexible leggings will support you in all the...
Sale 50% off
Grilla Squad Slim Fit Bottoms Grilla Squad Slim Fit Bottoms
{"id":8782659529,"title":"Grilla Squad Slim Fit Bottoms","handle":"grilla-squad-slim-fit-bottoms-navy","description":"The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped pocket.\u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Reverse Zip Pocket\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e 60% Polyester 35% Cotton 5% Elastane \u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL","published_at":"2017-01-31T14:44:00+00:00","created_at":"2017-01-31T14:44:25+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":1300,"price_min":1300,"price_max":1300,"available":true,"price_varies":false,"compare_at_price":2600,"compare_at_price_min":2600,"compare_at_price_max":2600,"compare_at_price_varies":false,"variants":[{"id":30067887497,"title":"S","option1":"S","option2":null,"option3":null,"sku":"SquadJNS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353378697,"product_id":8782659529,"position":1,"created_at":"2017-01-31T14:44:25+00:00","updated_at":"2017-01-31T14:44:25+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsnavyfront.jpg?v=1485873865","variant_ids":[30067887497,30067887561,30067887625,30067887689]},"available":true,"name":"Grilla Squad Slim Fit Bottoms - S","public_title":"S","options":["S"],"price":1300,"weight":4000,"compare_at_price":2600,"inventory_quantity":37,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090406"},{"id":30067887561,"title":"M","option1":"M","option2":null,"option3":null,"sku":"SquadJNM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353378697,"product_id":8782659529,"position":1,"created_at":"2017-01-31T14:44:25+00:00","updated_at":"2017-01-31T14:44:25+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsnavyfront.jpg?v=1485873865","variant_ids":[30067887497,30067887561,30067887625,30067887689]},"available":true,"name":"Grilla Squad Slim Fit Bottoms - M","public_title":"M","options":["M"],"price":1300,"weight":4000,"compare_at_price":2600,"inventory_quantity":22,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090413"},{"id":30067887625,"title":"L","option1":"L","option2":null,"option3":null,"sku":"SquadJNL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353378697,"product_id":8782659529,"position":1,"created_at":"2017-01-31T14:44:25+00:00","updated_at":"2017-01-31T14:44:25+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsnavyfront.jpg?v=1485873865","variant_ids":[30067887497,30067887561,30067887625,30067887689]},"available":true,"name":"Grilla Squad Slim Fit Bottoms - L","public_title":"L","options":["L"],"price":1300,"weight":4000,"compare_at_price":2600,"inventory_quantity":24,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090420"},{"id":30067887689,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"SquadJNXL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353378697,"product_id":8782659529,"position":1,"created_at":"2017-01-31T14:44:25+00:00","updated_at":"2017-01-31T14:44:25+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsnavyfront.jpg?v=1485873865","variant_ids":[30067887497,30067887561,30067887625,30067887689]},"available":true,"name":"Grilla Squad Slim Fit Bottoms - XL","public_title":"XL","options":["XL"],"price":1300,"weight":4000,"compare_at_price":2600,"inventory_quantity":14,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090437"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsnavyfront.jpg?v=1485873865","\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsnavyback.jpg?v=1485873865"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsnavyfront.jpg?v=1485873865","options":["size"],"content":"The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped pocket.\u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Reverse Zip Pocket\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e 60% Polyester 35% Cotton 5% Elastane \u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL"}

Grilla Squad Slim Fit Bottoms

£13.00 £26.00

Grilla Squad Slim Fit Bottoms

£13.00 £26.00
The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include "Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped...
Sale 50% off
Grilla Squad Slim Fit Bottoms Grilla Squad Slim Fit Bottoms
{"id":8782660681,"title":"Grilla Squad Slim Fit Bottoms","handle":"grilla-squad-slim-fit-bottoms-black","description":"The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped pocket.\u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Reverse Zip Pocket\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL 60% Polyester 35% Cotton 5% Elastane","published_at":"2017-01-31T14:44:00+00:00","created_at":"2017-01-31T14:44:35+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":1300,"price_min":1300,"price_max":1300,"available":true,"price_varies":false,"compare_at_price":2600,"compare_at_price_min":2600,"compare_at_price_max":2600,"compare_at_price_varies":false,"variants":[{"id":30067896841,"title":"S","option1":"S","option2":null,"option3":null,"sku":"SquadJBS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353382537,"product_id":8782660681,"position":1,"created_at":"2017-01-31T14:44:35+00:00","updated_at":"2017-01-31T14:44:35+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackfront.jpg?v=1485873875","variant_ids":[30067896841,30067897033,30067897161,30067897289]},"available":true,"name":"Grilla Squad Slim Fit Bottoms - S","public_title":"S","options":["S"],"price":1300,"weight":4000,"compare_at_price":2600,"inventory_quantity":24,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090369"},{"id":30067897033,"title":"M","option1":"M","option2":null,"option3":null,"sku":"SquadJBM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353382537,"product_id":8782660681,"position":1,"created_at":"2017-01-31T14:44:35+00:00","updated_at":"2017-01-31T14:44:35+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackfront.jpg?v=1485873875","variant_ids":[30067896841,30067897033,30067897161,30067897289]},"available":true,"name":"Grilla Squad Slim Fit Bottoms - M","public_title":"M","options":["M"],"price":1300,"weight":4000,"compare_at_price":2600,"inventory_quantity":12,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090376"},{"id":30067897161,"title":"L","option1":"L","option2":null,"option3":null,"sku":"SquadJBL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353382537,"product_id":8782660681,"position":1,"created_at":"2017-01-31T14:44:35+00:00","updated_at":"2017-01-31T14:44:35+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackfront.jpg?v=1485873875","variant_ids":[30067896841,30067897033,30067897161,30067897289]},"available":true,"name":"Grilla Squad Slim Fit Bottoms - L","public_title":"L","options":["L"],"price":1300,"weight":4000,"compare_at_price":2600,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090383"},{"id":30067897289,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"SquadJBXL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353382537,"product_id":8782660681,"position":1,"created_at":"2017-01-31T14:44:35+00:00","updated_at":"2017-01-31T14:44:35+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackfront.jpg?v=1485873875","variant_ids":[30067896841,30067897033,30067897161,30067897289]},"available":true,"name":"Grilla Squad Slim Fit Bottoms - XL","public_title":"XL","options":["XL"],"price":1300,"weight":4000,"compare_at_price":2600,"inventory_quantity":11,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090390"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackfront.jpg?v=1485873875","\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackback.jpg?v=1485873875","\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackalternative.jpg?v=1485873875","\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackzip2.jpg?v=1485873875","\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackzip.jpg?v=1485873875"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackfront.jpg?v=1485873875","options":["size"],"content":"The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped pocket.\u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Reverse Zip Pocket\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL 60% Polyester 35% Cotton 5% Elastane"}

Grilla Squad Slim Fit Bottoms

£13.00 £26.00

Grilla Squad Slim Fit Bottoms

£13.00 £26.00
The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include "Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped...
Sale 50% off
Grilla Squad Hoodie
{"id":8782656457,"title":"Grilla Squad Slim Fit Hoodie","handle":"grilla-squad-slim-fit-hoodie-grey-navy","description":"The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical zipped pockets.\u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Zipped Pockets\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL","published_at":"2017-01-31T14:44:00+00:00","created_at":"2017-01-31T14:44:08+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":1350,"price_min":1350,"price_max":1350,"available":true,"price_varies":false,"compare_at_price":2700,"compare_at_price_min":2700,"compare_at_price_max":2700,"compare_at_price_varies":false,"variants":[{"id":30067873353,"title":"S","option1":"S","option2":null,"option3":null,"sku":"SquadHNS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353375433,"product_id":8782656457,"position":1,"created_at":"2017-01-31T14:44:08+00:00","updated_at":"2017-01-31T14:44:09+00:00","alt":"Grilla Squad Hoodie","width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodienavybluefront_1.jpg?v=1485873849","variant_ids":[30067873353,30067873481,30067873609,30067873801]},"available":true,"name":"Grilla Squad Slim Fit Hoodie - S","public_title":"S","options":["S"],"price":1350,"weight":4000,"compare_at_price":2700,"inventory_quantity":57,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090482"},{"id":30067873481,"title":"M","option1":"M","option2":null,"option3":null,"sku":"SquadHNM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353375433,"product_id":8782656457,"position":1,"created_at":"2017-01-31T14:44:08+00:00","updated_at":"2017-01-31T14:44:09+00:00","alt":"Grilla Squad Hoodie","width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodienavybluefront_1.jpg?v=1485873849","variant_ids":[30067873353,30067873481,30067873609,30067873801]},"available":true,"name":"Grilla Squad Slim Fit Hoodie - M","public_title":"M","options":["M"],"price":1350,"weight":4000,"compare_at_price":2700,"inventory_quantity":18,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090499"},{"id":30067873609,"title":"L","option1":"L","option2":null,"option3":null,"sku":"SquadHNL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353375433,"product_id":8782656457,"position":1,"created_at":"2017-01-31T14:44:08+00:00","updated_at":"2017-01-31T14:44:09+00:00","alt":"Grilla Squad Hoodie","width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodienavybluefront_1.jpg?v=1485873849","variant_ids":[30067873353,30067873481,30067873609,30067873801]},"available":true,"name":"Grilla Squad Slim Fit Hoodie - L","public_title":"L","options":["L"],"price":1350,"weight":4000,"compare_at_price":2700,"inventory_quantity":17,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090505"},{"id":30067873801,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"SquadHNXL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353375433,"product_id":8782656457,"position":1,"created_at":"2017-01-31T14:44:08+00:00","updated_at":"2017-01-31T14:44:09+00:00","alt":"Grilla Squad Hoodie","width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodienavybluefront_1.jpg?v=1485873849","variant_ids":[30067873353,30067873481,30067873609,30067873801]},"available":true,"name":"Grilla Squad Slim Fit Hoodie - XL","public_title":"XL","options":["XL"],"price":1350,"weight":4000,"compare_at_price":2700,"inventory_quantity":15,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090512"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodienavybluefront_1.jpg?v=1485873849"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodienavybluefront_1.jpg?v=1485873849","options":["size"],"content":"The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical zipped pockets.\u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Zipped Pockets\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL"}

Grilla Squad Slim Fit Hoodie

£13.50 £27.00

Grilla Squad Slim Fit Hoodie

£13.50 £27.00
The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include "Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical...
Sale 50% off
Grilla Squad Slim Fit Hoodie Grilla Squad Slim Fit Hoodie
{"id":8782657417,"title":"Grilla Squad Slim Fit Hoodie","handle":"grilla-squad-slim-fit-hoodie-1","description":"The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical zipped pockets.\u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Zipped Pockets\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e 60% Polyester 35% Cotton 5% Elastane","published_at":"2017-01-31T14:44:14+00:00","created_at":"2017-01-31T14:44:18+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":1350,"price_min":1350,"price_max":1350,"available":true,"price_varies":false,"compare_at_price":2700,"compare_at_price_min":2700,"compare_at_price_max":2700,"compare_at_price_varies":false,"variants":[{"id":30067881673,"title":"S","option1":"S","option2":null,"option3":null,"sku":"SquadHBS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353377033,"product_id":8782657417,"position":1,"created_at":"2017-01-31T14:44:18+00:00","updated_at":"2017-01-31T14:44:18+00:00","alt":"Grilla Squad Slim Fit Hoodie","width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodieblackfront.jpg?v=1485873858","variant_ids":[30067881673,30067881737,30067881801,30067881865]},"available":true,"name":"Grilla Squad Slim Fit Hoodie - S","public_title":"S","options":["S"],"price":1350,"weight":4000,"compare_at_price":2700,"inventory_quantity":30,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090444"},{"id":30067881737,"title":"M","option1":"M","option2":null,"option3":null,"sku":"SquadHBM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353377033,"product_id":8782657417,"position":1,"created_at":"2017-01-31T14:44:18+00:00","updated_at":"2017-01-31T14:44:18+00:00","alt":"Grilla Squad Slim Fit Hoodie","width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodieblackfront.jpg?v=1485873858","variant_ids":[30067881673,30067881737,30067881801,30067881865]},"available":true,"name":"Grilla Squad Slim Fit Hoodie - M","public_title":"M","options":["M"],"price":1350,"weight":4000,"compare_at_price":2700,"inventory_quantity":16,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090451"},{"id":30067881801,"title":"L","option1":"L","option2":null,"option3":null,"sku":"SquadHBL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353377033,"product_id":8782657417,"position":1,"created_at":"2017-01-31T14:44:18+00:00","updated_at":"2017-01-31T14:44:18+00:00","alt":"Grilla Squad Slim Fit Hoodie","width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodieblackfront.jpg?v=1485873858","variant_ids":[30067881673,30067881737,30067881801,30067881865]},"available":true,"name":"Grilla Squad Slim Fit Hoodie - L","public_title":"L","options":["L"],"price":1350,"weight":4000,"compare_at_price":2700,"inventory_quantity":9,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090468"},{"id":30067881865,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"SquadHBXL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353377033,"product_id":8782657417,"position":1,"created_at":"2017-01-31T14:44:18+00:00","updated_at":"2017-01-31T14:44:18+00:00","alt":"Grilla Squad Slim Fit Hoodie","width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodieblackfront.jpg?v=1485873858","variant_ids":[30067881673,30067881737,30067881801,30067881865]},"available":true,"name":"Grilla Squad Slim Fit Hoodie - XL","public_title":"XL","options":["XL"],"price":1350,"weight":4000,"compare_at_price":2700,"inventory_quantity":19,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090475"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodieblackfront.jpg?v=1485873858","\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodieblackback.jpg?v=1485873858","\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodieblackside.jpg?v=1485873858","\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodieblackalternative.jpg?v=1485873858"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodieblackfront.jpg?v=1485873858","options":["size"],"content":"The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical zipped pockets.\u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Zipped Pockets\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e 60% Polyester 35% Cotton 5% Elastane"}

Grilla Squad Slim Fit Hoodie

£13.50 £27.00

Grilla Squad Slim Fit Hoodie

£13.50 £27.00
The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include "Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical...
Sale 50% off
Grilla Squad Tracksuit
{"id":8782663305,"title":"Grilla Squad Tracksuit","handle":"full-grilla-squad-slim-fit-outfit-grey-navy","description":"The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped pocket.\u003cbr\u003e \u003cbr\u003e \u003cbr\u003e \u003cbr\u003e The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical zipped pockets.\u003cbr\u003e \u003cbr\u003e \u003cbr\u003e \u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Reverse Zip Pocket\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL 60% Polyester 35% Cotton 5% Elastane","published_at":"2017-01-31T14:45:00+00:00","created_at":"2017-01-31T14:45:01+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":2750,"price_min":2750,"price_max":2750,"available":true,"price_varies":false,"compare_at_price":5500,"compare_at_price_min":5500,"compare_at_price_max":5500,"compare_at_price_varies":false,"variants":[{"id":30067916681,"title":"S","option1":"S","option2":null,"option3":null,"sku":"FullSquadN-S","requires_shipping":true,"taxable":false,"featured_image":{"id":18353393097,"product_id":8782663305,"position":1,"created_at":"2017-01-31T14:45:01+00:00","updated_at":"2017-01-31T14:45:01+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitgrey.jpg?v=1485873901","variant_ids":[30067916681,31418462665,31418462729,31418462793]},"available":true,"name":"Grilla Squad Tracksuit - S","public_title":"S","options":["S"],"price":2750,"weight":4000,"compare_at_price":5500,"inventory_quantity":197,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090260"},{"id":31418462665,"title":"M","option1":"M","option2":null,"option3":null,"sku":"FullSquadN-M","requires_shipping":true,"taxable":false,"featured_image":{"id":18353393097,"product_id":8782663305,"position":1,"created_at":"2017-01-31T14:45:01+00:00","updated_at":"2017-01-31T14:45:01+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitgrey.jpg?v=1485873901","variant_ids":[30067916681,31418462665,31418462729,31418462793]},"available":true,"name":"Grilla Squad Tracksuit - M","public_title":"M","options":["M"],"price":2750,"weight":4000,"compare_at_price":5500,"inventory_quantity":193,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090277"},{"id":31418462729,"title":"L","option1":"L","option2":null,"option3":null,"sku":"FullSquadN-L","requires_shipping":true,"taxable":false,"featured_image":{"id":18353393097,"product_id":8782663305,"position":1,"created_at":"2017-01-31T14:45:01+00:00","updated_at":"2017-01-31T14:45:01+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitgrey.jpg?v=1485873901","variant_ids":[30067916681,31418462665,31418462729,31418462793]},"available":true,"name":"Grilla Squad Tracksuit - L","public_title":"L","options":["L"],"price":2750,"weight":4000,"compare_at_price":5500,"inventory_quantity":194,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090284"},{"id":31418462793,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"FullSquadN-XL","requires_shipping":true,"taxable":false,"featured_image":{"id":18353393097,"product_id":8782663305,"position":1,"created_at":"2017-01-31T14:45:01+00:00","updated_at":"2017-01-31T14:45:01+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitgrey.jpg?v=1485873901","variant_ids":[30067916681,31418462665,31418462729,31418462793]},"available":true,"name":"Grilla Squad Tracksuit - XL","public_title":"XL","options":["XL"],"price":2750,"weight":4000,"compare_at_price":5500,"inventory_quantity":196,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090291"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitgrey.jpg?v=1485873901"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitgrey.jpg?v=1485873901","options":["Size"],"content":"The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped pocket.\u003cbr\u003e \u003cbr\u003e \u003cbr\u003e \u003cbr\u003e The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical zipped pockets.\u003cbr\u003e \u003cbr\u003e \u003cbr\u003e \u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Reverse Zip Pocket\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL 60% Polyester 35% Cotton 5% Elastane"}

Grilla Squad Tracksuit

£27.50 £55.00

Grilla Squad Tracksuit

£27.50 £55.00
The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include "Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped...
Sale 50% off
Grilla Squad Tracksuit Grilla Squad Tracksuit
{"id":8782663817,"title":"Grilla Squad Tracksuit","handle":"grilla-squad-tracksuit-black","description":"The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped pocket.\u003cbr\u003e \u003cbr\u003e \u003cbr\u003e \u003cbr\u003e The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical zipped pockets.\u003cbr\u003e \u003cbr\u003e \u003cbr\u003e \u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Reverse Zip Pocket\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL 60% Polyester 35% Cotton 5% Elastane","published_at":"2017-01-31T14:45:00+00:00","created_at":"2017-01-31T14:45:06+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":2750,"price_min":2750,"price_max":2750,"available":true,"price_varies":false,"compare_at_price":5500,"compare_at_price_min":5500,"compare_at_price_max":5500,"compare_at_price_varies":false,"variants":[{"id":30067917385,"title":"S","option1":"S","option2":null,"option3":null,"sku":"FullSquadB-S","requires_shipping":true,"taxable":false,"featured_image":{"id":18353394249,"product_id":8782663817,"position":1,"created_at":"2017-01-31T14:45:06+00:00","updated_at":"2017-01-31T14:45:06+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitblackfront.jpg?v=1485873906","variant_ids":[30067917385,31418543753,31418543817,31418543881]},"available":true,"name":"Grilla Squad Tracksuit - S","public_title":"S","options":["S"],"price":2750,"weight":4000,"compare_at_price":5500,"inventory_quantity":193,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090222"},{"id":31418543753,"title":"M","option1":"M","option2":null,"option3":null,"sku":"FullSquadB-M","requires_shipping":true,"taxable":false,"featured_image":{"id":18353394249,"product_id":8782663817,"position":1,"created_at":"2017-01-31T14:45:06+00:00","updated_at":"2017-01-31T14:45:06+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitblackfront.jpg?v=1485873906","variant_ids":[30067917385,31418543753,31418543817,31418543881]},"available":true,"name":"Grilla Squad Tracksuit - M","public_title":"M","options":["M"],"price":2750,"weight":4000,"compare_at_price":5500,"inventory_quantity":190,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090239"},{"id":31418543817,"title":"L","option1":"L","option2":null,"option3":null,"sku":"FullSquadB-L","requires_shipping":true,"taxable":false,"featured_image":{"id":18353394249,"product_id":8782663817,"position":1,"created_at":"2017-01-31T14:45:06+00:00","updated_at":"2017-01-31T14:45:06+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitblackfront.jpg?v=1485873906","variant_ids":[30067917385,31418543753,31418543817,31418543881]},"available":true,"name":"Grilla Squad Tracksuit - L","public_title":"L","options":["L"],"price":2750,"weight":4000,"compare_at_price":5500,"inventory_quantity":194,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090246"},{"id":31418543881,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"FullSquadB-XL","requires_shipping":true,"taxable":false,"featured_image":{"id":18353394249,"product_id":8782663817,"position":1,"created_at":"2017-01-31T14:45:06+00:00","updated_at":"2017-01-31T14:45:06+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitblackfront.jpg?v=1485873906","variant_ids":[30067917385,31418543753,31418543817,31418543881]},"available":true,"name":"Grilla Squad Tracksuit - XL","public_title":"XL","options":["XL"],"price":2750,"weight":4000,"compare_at_price":5500,"inventory_quantity":196,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090253"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitblackfront.jpg?v=1485873906","\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitblackback.jpg?v=1485873906"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitblackfront.jpg?v=1485873906","options":["Size"],"content":"The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped pocket.\u003cbr\u003e \u003cbr\u003e \u003cbr\u003e \u003cbr\u003e The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical zipped pockets.\u003cbr\u003e \u003cbr\u003e \u003cbr\u003e \u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Reverse Zip Pocket\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL 60% Polyester 35% Cotton 5% Elastane"}

Grilla Squad Tracksuit

£27.50 £55.00

Grilla Squad Tracksuit

£27.50 £55.00
The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include "Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped...
Grilla Water Bottle Jug
{"id":10461703177,"title":"Grilla Water Bottle Jug","handle":"grilla-water-bottle-jug-pink","description":"\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003eStay hydrated with this pink gym drinking bottle. At 1.89 litres it's the most convenient way of carrying your water and why not add your supplements such as BCAA's or pre-workout.\u003c\/p\u003e\n\u003cp\u003eThese bottles are the most stylish way of staying hydrated all day while on the go or working those sets at the gym.\u003c\/p\u003e","published_at":"2017-09-26T00:16:43+01:00","created_at":"2017-09-26T00:20:12+01:00","vendor":"Grilla Fitness","type":"ACCESSORIES","tags":[],"price":899,"price_min":899,"price_max":899,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":46211787017,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"GrillaWtrJugPnk","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Grilla Water Bottle Jug","public_title":null,"options":["Default Title"],"price":899,"weight":160,"compare_at_price":null,"inventory_quantity":820,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090154"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/GrillaWaterJug-Pink_3cf2e3c8-c334-4b7b-8cb5-4d08a2a0f069.jpg?v=1506958085"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/GrillaWaterJug-Pink_3cf2e3c8-c334-4b7b-8cb5-4d08a2a0f069.jpg?v=1506958085","options":["Title"],"content":"\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003eStay hydrated with this pink gym drinking bottle. At 1.89 litres it's the most convenient way of carrying your water and why not add your supplements such as BCAA's or pre-workout.\u003c\/p\u003e\n\u003cp\u003eThese bottles are the most stylish way of staying hydrated all day while on the go or working those sets at the gym.\u003c\/p\u003e"}

Grilla Water Bottle Jug

Stay hydrated with this pink gym drinking bottle. At 1.89 litres it's the most convenient way of carrying your water and why not add your supplements such as BCAA's or pre-workout. These bottles are the most stylish way of staying hydrated all day while on the go or working those sets at the gym.
Grilla Water Bottle Jug
{"id":17647861769,"title":"Grilla Water Bottle Jug","handle":"grilla-water-bottle-jug-blue","description":"\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003eStay hydrated with this blue gym drinking bottle. At 1.89 litres it's the most convenient way of carrying your water and why not add your supplements such as BCAA's or pre-workout.\u003c\/p\u003e\n\u003cp\u003eThese bottles are the most stylish way of staying hydrated all day while on the go or working those sets at the gym.\u003c\/p\u003e","published_at":"2017-09-26T00:16:43+01:00","created_at":"2017-10-02T16:32:52+01:00","vendor":"Grilla Fitness","type":"ACCESSORIES","tags":[],"price":899,"price_min":899,"price_max":899,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":135182811145,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"GrillaWtrJugBlu","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Grilla Water Bottle Jug","public_title":null,"options":["Default Title"],"price":899,"weight":160,"compare_at_price":null,"inventory_quantity":899,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090147"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/GrillaWaterJug-Blue.jpg?v=1506958388"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/GrillaWaterJug-Blue.jpg?v=1506958388","options":["Title"],"content":"\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003eStay hydrated with this blue gym drinking bottle. At 1.89 litres it's the most convenient way of carrying your water and why not add your supplements such as BCAA's or pre-workout.\u003c\/p\u003e\n\u003cp\u003eThese bottles are the most stylish way of staying hydrated all day while on the go or working those sets at the gym.\u003c\/p\u003e"}

Grilla Water Bottle Jug

Stay hydrated with this blue gym drinking bottle. At 1.89 litres it's the most convenient way of carrying your water and why not add your supplements such as BCAA's or pre-workout. These bottles are the most stylish way of staying hydrated all day while on the go or working those sets at the gym.
Grilla Water Bottle Jug
{"id":17649696777,"title":"Grilla Water Bottle Jug","handle":"grilla-water-bottle-jug-black","description":"\u003cp\u003eStay hydrated with this black gym drinking bottle. At 1.89 litres it's the most convenient way of carrying your water and why not add your supplements such as BCAA's or pre-workout.\u003c\/p\u003e\n\u003cp\u003eThese bottles are the most stylish way of staying hydrated all day while on the go or working those sets at the gym.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e","published_at":"2017-09-26T00:16:43+01:00","created_at":"2017-10-02T16:35:01+01:00","vendor":"Grilla Fitness","type":"ACCESSORIES","tags":[],"price":899,"price_min":899,"price_max":899,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":135234256905,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"GrillaWtrJugBlk","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Grilla Water Bottle Jug","public_title":null,"options":["Default Title"],"price":899,"weight":160,"compare_at_price":null,"inventory_quantity":734,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090130"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/GrillaWaterJug-Black.jpg?v=1506958516"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/GrillaWaterJug-Black.jpg?v=1506958516","options":["Title"],"content":"\u003cp\u003eStay hydrated with this black gym drinking bottle. At 1.89 litres it's the most convenient way of carrying your water and why not add your supplements such as BCAA's or pre-workout.\u003c\/p\u003e\n\u003cp\u003eThese bottles are the most stylish way of staying hydrated all day while on the go or working those sets at the gym.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e"}

Grilla Water Bottle Jug

Stay hydrated with this black gym drinking bottle. At 1.89 litres it's the most convenient way of carrying your water and why not add your supplements such as BCAA's or pre-workout. These bottles are the most stylish way of staying hydrated all day while on the go or working those sets at the gym.  ...
{"id":65119977481,"title":"Hey-Glo","handle":"hey-glo-hair-skin-nails","description":"\u003cp\u003eHey.....boost your inner Glo!\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eHey-Glo is a complex of vitamins, minerals  and detoxifiers combined to unleash your inner glow! Vitamin C boosts energy levels and contributes to collagen formation which helps resist the onset of wrinkles. Zinc, Vitamin A and Biotin, aid in promoting a healthy skin glow, whilst nourishing hair and nails. \u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eDirections for Use\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eAdults, take 2 capsules per day with food and water. Do not exceed recommended daily dose. Not suitable for Vegans or Vegetarians\u003c\/p\u003e\n\u003ctable\u003e\n\u003ctbody\u003e\n\u003ctr\u003e\n\u003ctd\u003e\u003cstrong\u003eNutritional information\u003c\/strong\u003e\u003c\/td\u003e\n\u003ctd\u003e\u003c\/td\u003e\n\u003ctd\u003e\u003cstrong\u003e*%NRV\u003c\/strong\u003e\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eVitamin A\u003cspan\u003e\u003c\/span\u003e\n\u003c\/td\u003e\n\u003ctd\u003e120ug\u003c\/td\u003e\n\u003ctd\u003e15\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eVitamin E\u003c\/td\u003e\n\u003ctd\u003e1.8mg a-TE\u003c\/td\u003e\n\u003ctd\u003e15\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eVitamin C\u003c\/td\u003e\n\u003ctd\u003e12mg\u003c\/td\u003e\n\u003ctd\u003e15\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eRiboflavin (vitamin B2)\u003c\/td\u003e\n\u003ctd\u003e0.21mg\u003c\/td\u003e\n\u003ctd\u003e15\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eNiacin (vitamin B3)\u003c\/td\u003e\n\u003ctd\u003e2.4mg\u003c\/td\u003e\n\u003ctd\u003e15\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eBiotin\u003c\/td\u003e\n\u003ctd\u003e7.5μg\u003c\/td\u003e\n\u003ctd\u003e15\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eIodine (From Hebridean Seaweed)\u003c\/td\u003e\n\u003ctd\u003e22.5μg\u003c\/td\u003e\n\u003ctd\u003e15\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eZinc\u003c\/td\u003e\n\u003ctd\u003e1.5mg\u003c\/td\u003e\n\u003ctd\u003e\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003e\u003c\/td\u003e\n\u003ctd\u003e\u003c\/td\u003e\n\u003ctd\u003e\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003e\u003cstrong\u003eAlso provides\u003c\/strong\u003e\u003c\/td\u003e\n\u003ctd\u003e\u003c\/td\u003e\n\u003ctd\u003e\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eMarine Collagen\u003c\/td\u003e\n\u003ctd\u003e300mg\u003c\/td\u003e\n\u003ctd\u003e\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eAcerola Cherry Extract (Providing Vitamin C)\u003c\/td\u003e\n\u003ctd\u003e50mg\u003c\/td\u003e\n\u003ctd\u003e\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eHebridean Seaweed (Providing Iodine)\u003c\/td\u003e\n\u003ctd\u003e38.5mg\u003c\/td\u003e\n\u003ctd\u003e\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eCoconut Water (From Cocomineral)\u003c\/td\u003e\n\u003ctd\u003e30mg\u003c\/td\u003e\n\u003ctd\u003e\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eAloe Vera Equivalent \u003c\/td\u003e\n\u003ctd\u003e1000mg\u003c\/td\u003e\n\u003ctd\u003e\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eFrom Aloe Vera Extract\u003c\/td\u003e\n\u003ctd\u003e5mg\u003c\/td\u003e\n\u003ctd\u003e\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003e\u003cstrong\u003e*Nutrient Reference Value\u003c\/strong\u003e\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003c\/tbody\u003e\n\u003c\/table\u003e","published_at":"2017-11-10T15:44:39+00:00","created_at":"2017-11-07T09:36:09+00:00","vendor":"Grilla Fitness","type":"SUPPLEMENTS","tags":["Beauty","Hair","Nails","Skin"],"price":1800,"price_min":1800,"price_max":1800,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":655240331273,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"HEYGLO60","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Hey-Glo","public_title":null,"options":["Default Title"],"price":1800,"weight":42,"compare_at_price":null,"inventory_quantity":371,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090024"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/heyglo.png?v=1564599976"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/heyglo.png?v=1564599976","options":["Title"],"content":"\u003cp\u003eHey.....boost your inner Glo!\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eHey-Glo is a complex of vitamins, minerals  and detoxifiers combined to unleash your inner glow! Vitamin C boosts energy levels and contributes to collagen formation which helps resist the onset of wrinkles. Zinc, Vitamin A and Biotin, aid in promoting a healthy skin glow, whilst nourishing hair and nails. \u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eDirections for Use\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eAdults, take 2 capsules per day with food and water. Do not exceed recommended daily dose. Not suitable for Vegans or Vegetarians\u003c\/p\u003e\n\u003ctable\u003e\n\u003ctbody\u003e\n\u003ctr\u003e\n\u003ctd\u003e\u003cstrong\u003eNutritional information\u003c\/strong\u003e\u003c\/td\u003e\n\u003ctd\u003e\u003c\/td\u003e\n\u003ctd\u003e\u003cstrong\u003e*%NRV\u003c\/strong\u003e\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eVitamin A\u003cspan\u003e\u003c\/span\u003e\n\u003c\/td\u003e\n\u003ctd\u003e120ug\u003c\/td\u003e\n\u003ctd\u003e15\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eVitamin E\u003c\/td\u003e\n\u003ctd\u003e1.8mg a-TE\u003c\/td\u003e\n\u003ctd\u003e15\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eVitamin C\u003c\/td\u003e\n\u003ctd\u003e12mg\u003c\/td\u003e\n\u003ctd\u003e15\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eRiboflavin (vitamin B2)\u003c\/td\u003e\n\u003ctd\u003e0.21mg\u003c\/td\u003e\n\u003ctd\u003e15\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eNiacin (vitamin B3)\u003c\/td\u003e\n\u003ctd\u003e2.4mg\u003c\/td\u003e\n\u003ctd\u003e15\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eBiotin\u003c\/td\u003e\n\u003ctd\u003e7.5μg\u003c\/td\u003e\n\u003ctd\u003e15\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eIodine (From Hebridean Seaweed)\u003c\/td\u003e\n\u003ctd\u003e22.5μg\u003c\/td\u003e\n\u003ctd\u003e15\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eZinc\u003c\/td\u003e\n\u003ctd\u003e1.5mg\u003c\/td\u003e\n\u003ctd\u003e\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003e\u003c\/td\u003e\n\u003ctd\u003e\u003c\/td\u003e\n\u003ctd\u003e\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003e\u003cstrong\u003eAlso provides\u003c\/strong\u003e\u003c\/td\u003e\n\u003ctd\u003e\u003c\/td\u003e\n\u003ctd\u003e\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eMarine Collagen\u003c\/td\u003e\n\u003ctd\u003e300mg\u003c\/td\u003e\n\u003ctd\u003e\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eAcerola Cherry Extract (Providing Vitamin C)\u003c\/td\u003e\n\u003ctd\u003e50mg\u003c\/td\u003e\n\u003ctd\u003e\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eHebridean Seaweed (Providing Iodine)\u003c\/td\u003e\n\u003ctd\u003e38.5mg\u003c\/td\u003e\n\u003ctd\u003e\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eCoconut Water (From Cocomineral)\u003c\/td\u003e\n\u003ctd\u003e30mg\u003c\/td\u003e\n\u003ctd\u003e\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eAloe Vera Equivalent \u003c\/td\u003e\n\u003ctd\u003e1000mg\u003c\/td\u003e\n\u003ctd\u003e\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003eFrom Aloe Vera Extract\u003c\/td\u003e\n\u003ctd\u003e5mg\u003c\/td\u003e\n\u003ctd\u003e\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003e\u003cstrong\u003e*Nutrient Reference Value\u003c\/strong\u003e\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003c\/tbody\u003e\n\u003c\/table\u003e"}

Hair - Skin - Nails



Hey.....boost your inner Glo!   Hey-Glo is a complex of vitamins, minerals  and detoxifiers combined to unleash your inner glow! Vitamin C boosts energy levels and contributes to collagen formation which helps resist the onset of wrinkles. Zinc, Vitamin A and Biotin, aid in promoting a healthy skin glow, whilst nourishing hair and nails.  Directions for Use Adults, take 2...