Summer Sale

Sale 50% off
Grilla Cobra Breathable Vest Grilla Cobra Breathable Vest
{"id":8782651785,"title":"Grilla Cobra Breathable Vest","handle":"grilla-cobra-breathable-vest-black","description":"The Grilla Cobra breathable Tank is part of our launch collection. This Tank uses a high quality performance material which is fitted yet allows freedom of movement. It includes a breathable mesh panel on the back which is visually striking as well as cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e 92% Polyester 8% Elastane \u003cbr\u003e Model is 6,4 and wears large","published_at":"2017-01-31T14:43:00+00:00","created_at":"2017-01-31T14:43:19+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":700,"price_min":700,"price_max":700,"available":true,"price_varies":false,"compare_at_price":1400,"compare_at_price_min":1400,"compare_at_price_max":1400,"compare_at_price_varies":false,"variants":[{"id":30067843657,"title":"S","option1":"S","option2":null,"option3":null,"sku":"CobraBS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353361545,"product_id":8782651785,"position":1,"created_at":"2017-01-31T14:43:19+00:00","updated_at":"2017-01-31T14:43:19+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestblackfront.jpg?v=1485873799","variant_ids":[30067843657,30067843721,30067843785,30067843849]},"available":true,"name":"Grilla Cobra Breathable Vest - S","public_title":"S","options":["S"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":17,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090703"},{"id":30067843721,"title":"M","option1":"M","option2":null,"option3":null,"sku":"CobraBM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353361545,"product_id":8782651785,"position":1,"created_at":"2017-01-31T14:43:19+00:00","updated_at":"2017-01-31T14:43:19+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestblackfront.jpg?v=1485873799","variant_ids":[30067843657,30067843721,30067843785,30067843849]},"available":true,"name":"Grilla Cobra Breathable Vest - M","public_title":"M","options":["M"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":28,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090710"},{"id":30067843785,"title":"L","option1":"L","option2":null,"option3":null,"sku":"CobraBL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353361545,"product_id":8782651785,"position":1,"created_at":"2017-01-31T14:43:19+00:00","updated_at":"2017-01-31T14:43:19+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestblackfront.jpg?v=1485873799","variant_ids":[30067843657,30067843721,30067843785,30067843849]},"available":true,"name":"Grilla Cobra Breathable Vest - L","public_title":"L","options":["L"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":26,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090727"},{"id":30067843849,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"CobraBXL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353361545,"product_id":8782651785,"position":1,"created_at":"2017-01-31T14:43:19+00:00","updated_at":"2017-01-31T14:43:19+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestblackfront.jpg?v=1485873799","variant_ids":[30067843657,30067843721,30067843785,30067843849]},"available":true,"name":"Grilla Cobra Breathable Vest - XL","public_title":"XL","options":["XL"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":32,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090734"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestblackfront.jpg?v=1485873799","\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestblackback.jpg?v=1485873799","\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestblackfrontdetail.jpg?v=1485873799","\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestblackbackdetail.jpg?v=1485873799"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestblackfront.jpg?v=1485873799","options":["size"],"content":"The Grilla Cobra breathable Tank is part of our launch collection. This Tank uses a high quality performance material which is fitted yet allows freedom of movement. It includes a breathable mesh panel on the back which is visually striking as well as cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e 92% Polyester 8% Elastane \u003cbr\u003e Model is 6,4 and wears large"}

Grilla Cobra Breathable Vest

£7.00 £14.00

Grilla Cobra Breathable Vest

£7.00 £14.00
The Grilla Cobra breathable Tank is part of our launch collection. This Tank uses a high quality performance material which is fitted yet allows freedom of movement. It includes a breathable mesh panel on the back which is visually striking as well as cooling, promoting increased performance. Key notes Striking...
Sale 50% off
Grilla Cobra Breathable Vest Grilla Cobra Breathable Vest
{"id":8782652489,"title":"Grilla Cobra Breathable Vest","handle":"grilla-cobra-breathable-vest-white","description":"The Grilla Cobra breathable Tank is part of our launch collection. This Tank uses a high quality performance material which is fitted yet allows freedom of movement. It includes a breathable mesh panel on the back which is visually striking as well as cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e 92% Polyester 8% Elastane \u003cbr\u003e Model is 5,11 and wears medium","published_at":"2017-01-31T14:43:00+00:00","created_at":"2017-01-31T14:43:29+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":700,"price_min":700,"price_max":700,"available":true,"price_varies":false,"compare_at_price":1400,"compare_at_price_min":1400,"compare_at_price_max":1400,"compare_at_price_varies":false,"variants":[{"id":30067851785,"title":"S","option1":"S","option2":null,"option3":null,"sku":"CobraWS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353363401,"product_id":8782652489,"position":1,"created_at":"2017-01-31T14:43:29+00:00","updated_at":"2017-01-31T14:43:29+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestwhitefront.jpg?v=1485873809","variant_ids":[30067851785,30067851849,30067851913,30067851977]},"available":true,"name":"Grilla Cobra Breathable Vest - S","public_title":"S","options":["S"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":40,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090666"},{"id":30067851849,"title":"M","option1":"M","option2":null,"option3":null,"sku":"CobraWM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353363401,"product_id":8782652489,"position":1,"created_at":"2017-01-31T14:43:29+00:00","updated_at":"2017-01-31T14:43:29+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestwhitefront.jpg?v=1485873809","variant_ids":[30067851785,30067851849,30067851913,30067851977]},"available":true,"name":"Grilla Cobra Breathable Vest - M","public_title":"M","options":["M"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":28,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090673"},{"id":30067851977,"title":"L","option1":"L","option2":null,"option3":null,"sku":"CobraWL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353363401,"product_id":8782652489,"position":1,"created_at":"2017-01-31T14:43:29+00:00","updated_at":"2017-01-31T14:43:29+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestwhitefront.jpg?v=1485873809","variant_ids":[30067851785,30067851849,30067851913,30067851977]},"available":true,"name":"Grilla Cobra Breathable Vest - L","public_title":"L","options":["L"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":28,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090697"},{"id":30067851913,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"CobraWXL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353363401,"product_id":8782652489,"position":1,"created_at":"2017-01-31T14:43:29+00:00","updated_at":"2017-01-31T14:43:29+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestwhitefront.jpg?v=1485873809","variant_ids":[30067851785,30067851849,30067851913,30067851977]},"available":true,"name":"Grilla Cobra Breathable Vest - XL","public_title":"XL","options":["XL"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":21,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090680"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestwhitefront.jpg?v=1485873809","\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestwhiteback.jpg?v=1485873809","\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestwhitefrontdetail.jpg?v=1485873809","\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestwhitebackdetail.jpg?v=1485873809"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestwhitefront.jpg?v=1485873809","options":["size"],"content":"The Grilla Cobra breathable Tank is part of our launch collection. This Tank uses a high quality performance material which is fitted yet allows freedom of movement. It includes a breathable mesh panel on the back which is visually striking as well as cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e 92% Polyester 8% Elastane \u003cbr\u003e Model is 5,11 and wears medium"}

Grilla Cobra Breathable Vest

£7.00 £14.00

Grilla Cobra Breathable Vest

£7.00 £14.00
The Grilla Cobra breathable Tank is part of our launch collection. This Tank uses a high quality performance material which is fitted yet allows freedom of movement. It includes a breathable mesh panel on the back which is visually striking as well as cooling, promoting increased performance. Key notes Striking...
Sale 50% off
Grilla Freeflow Breathable Crew Grilla Freeflow Breathable Crew
{"id":8782653449,"title":"Grilla Freeflow Breathable Crew","handle":"grilla-freeflow-breathable-crew-grey","description":"The Grilla Freeflow breathable Crew is part of our launch collection. The Freeflow uses a high quality performance material which provides compression yet allows freedom for explosive movement when called upon. It includes breathable mesh panelling on the back which is arranged to the contours of the back muscles to give a physique enhancing result. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e Compression feel\u003cbr\u003e \u003cbr\u003e Model is 5,11 and wears medium","published_at":"2017-01-31T14:43:00+00:00","created_at":"2017-01-31T14:43:38+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":1000,"price_min":1000,"price_max":1000,"available":true,"price_varies":false,"compare_at_price":2000,"compare_at_price_min":2000,"compare_at_price_max":2000,"compare_at_price_varies":false,"variants":[{"id":30067859529,"title":"S","option1":"S","option2":null,"option3":null,"sku":"FreeflowGS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353365961,"product_id":8782653449,"position":1,"created_at":"2017-01-31T14:43:38+00:00","updated_at":"2017-01-31T14:43:38+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewfront.jpg?v=1485873818","variant_ids":[30067859529,30067859593,30067859657,30067859721]},"available":true,"name":"Grilla Freeflow Breathable Crew - S","public_title":"S","options":["S"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":350,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090628"},{"id":30067859593,"title":"M","option1":"M","option2":null,"option3":null,"sku":"FreeflowGM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353365961,"product_id":8782653449,"position":1,"created_at":"2017-01-31T14:43:38+00:00","updated_at":"2017-01-31T14:43:38+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewfront.jpg?v=1485873818","variant_ids":[30067859529,30067859593,30067859657,30067859721]},"available":true,"name":"Grilla Freeflow Breathable Crew - M","public_title":"M","options":["M"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":377,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090635"},{"id":30067859657,"title":"L","option1":"L","option2":null,"option3":null,"sku":"FreeflowGL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353365961,"product_id":8782653449,"position":1,"created_at":"2017-01-31T14:43:38+00:00","updated_at":"2017-01-31T14:43:38+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewfront.jpg?v=1485873818","variant_ids":[30067859529,30067859593,30067859657,30067859721]},"available":true,"name":"Grilla Freeflow Breathable Crew - L","public_title":"L","options":["L"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":278,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090642"},{"id":30067859721,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"FreeflowGXL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353365961,"product_id":8782653449,"position":1,"created_at":"2017-01-31T14:43:38+00:00","updated_at":"2017-01-31T14:43:38+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewfront.jpg?v=1485873818","variant_ids":[30067859529,30067859593,30067859657,30067859721]},"available":true,"name":"Grilla Freeflow Breathable Crew - XL","public_title":"XL","options":["XL"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":142,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090659"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewfront.jpg?v=1485873818","\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewback.jpg?v=1485873818"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewfront.jpg?v=1485873818","options":["size"],"content":"The Grilla Freeflow breathable Crew is part of our launch collection. The Freeflow uses a high quality performance material which provides compression yet allows freedom for explosive movement when called upon. It includes breathable mesh panelling on the back which is arranged to the contours of the back muscles to give a physique enhancing result. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e Compression feel\u003cbr\u003e \u003cbr\u003e Model is 5,11 and wears medium"}

Grilla Freeflow Breathable Crew

£10.00 £20.00

Grilla Freeflow Breathable Crew

£10.00 £20.00
The Grilla Freeflow breathable Crew is part of our launch collection. The Freeflow uses a high quality performance material which provides compression yet allows freedom for explosive movement when called upon. It includes breathable mesh panelling on the back which is arranged to the contours of the back muscles to...
Sale 50% off
Grilla Freeflow Breathable Crew
{"id":8782653897,"title":"Grilla Freeflow Breathable Crew","handle":"grilla-freeflow-breathable-crew-blue","description":"The Grilla Freeflow breathable Crew is part of our launch collection. The Freeflow uses a high quality performance material which provides compression yet allows freedom for explosive movement when called upon. It includes breathable mesh panelling on the back which is arranged to the contours of the back muscles to give a physique enhancing result. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e Compression feel\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears large","published_at":"2017-01-31T14:43:00+00:00","created_at":"2017-01-31T14:43:43+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":1000,"price_min":1000,"price_max":1000,"available":true,"price_varies":false,"compare_at_price":2000,"compare_at_price_min":2000,"compare_at_price_max":2000,"compare_at_price_varies":false,"variants":[{"id":30067860297,"title":"S","option1":"S","option2":null,"option3":null,"sku":"FreeflowBS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353367881,"product_id":8782653897,"position":1,"created_at":"2017-01-31T14:43:43+00:00","updated_at":"2017-01-31T14:43:43+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewbluefront.jpg?v=1485873823","variant_ids":[30067860297,30067860361,30067860425,30067860489]},"available":true,"name":"Grilla Freeflow Breathable Crew - S","public_title":"S","options":["S"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":77,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090581"},{"id":30067860361,"title":"M","option1":"M","option2":null,"option3":null,"sku":"FreeflowBM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353367881,"product_id":8782653897,"position":1,"created_at":"2017-01-31T14:43:43+00:00","updated_at":"2017-01-31T14:43:43+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewbluefront.jpg?v=1485873823","variant_ids":[30067860297,30067860361,30067860425,30067860489]},"available":true,"name":"Grilla Freeflow Breathable Crew - M","public_title":"M","options":["M"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":61,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090598"},{"id":30067860489,"title":"L","option1":"L","option2":null,"option3":null,"sku":"FreeflowBL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353367881,"product_id":8782653897,"position":1,"created_at":"2017-01-31T14:43:43+00:00","updated_at":"2017-01-31T14:43:43+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewbluefront.jpg?v=1485873823","variant_ids":[30067860297,30067860361,30067860425,30067860489]},"available":true,"name":"Grilla Freeflow Breathable Crew - L","public_title":"L","options":["L"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":51,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090611"},{"id":30067860425,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"FreeflowBXL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353367881,"product_id":8782653897,"position":1,"created_at":"2017-01-31T14:43:43+00:00","updated_at":"2017-01-31T14:43:43+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewbluefront.jpg?v=1485873823","variant_ids":[30067860297,30067860361,30067860425,30067860489]},"available":true,"name":"Grilla Freeflow Breathable Crew - XL","public_title":"XL","options":["XL"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":66,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090598"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewbluefront.jpg?v=1485873823"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewbluefront.jpg?v=1485873823","options":["size"],"content":"The Grilla Freeflow breathable Crew is part of our launch collection. The Freeflow uses a high quality performance material which provides compression yet allows freedom for explosive movement when called upon. It includes breathable mesh panelling on the back which is arranged to the contours of the back muscles to give a physique enhancing result. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e Compression feel\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears large"}

Grilla Freeflow Breathable Crew

£10.00 £20.00

Grilla Freeflow Breathable Crew

£10.00 £20.00
The Grilla Freeflow breathable Crew is part of our launch collection. The Freeflow uses a high quality performance material which provides compression yet allows freedom for explosive movement when called upon. It includes breathable mesh panelling on the back which is arranged to the contours of the back muscles to...
Sale 50% off
Grilla FreeStyle Breathable Vest Grilla FreeStyle Breathable Vest
{"id":8782654921,"title":"Grilla FreeStyle Breathable Vest","handle":"grilla-freestyle-breathable-vest-blue","description":"\u003cp\u003eThe Grilla FreeStyle breathable vest is part of our launch collection. The FreeStyle uses a high quality lightweight performance material which provides support yet figure flattering styling. It feels great to the touch, including breathable mesh panelling on the front and back which is arranged to the contours of the body. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Figure enhancing fit\u003cbr\u003e Light Weight yet high quality fabric\u003cbr\u003e Shell: 92% Polyester 8% Elastane \u003cbr\u003e Panel: 92% Polyester 8% Elastane \u003cbr\u003e \u003cbr\u003e Model is 5,6 and wears small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e","published_at":"2017-01-31T14:43:00+00:00","created_at":"2017-01-31T14:43:53+00:00","vendor":"Grilla Clothing","type":"WOMENS","tags":[],"price":700,"price_min":700,"price_max":700,"available":true,"price_varies":false,"compare_at_price":1400,"compare_at_price_min":1400,"compare_at_price_max":1400,"compare_at_price_varies":false,"variants":[{"id":30067865353,"title":"S","option1":"S","option2":null,"option3":null,"sku":"FreeStyleBS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353370185,"product_id":8782654921,"position":1,"created_at":"2017-01-31T14:43:53+00:00","updated_at":"2017-01-31T14:43:53+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestbluefront.jpg?v=1485873833","variant_ids":[30067865353,30067865481,30067865545]},"available":true,"name":"Grilla FreeStyle Breathable Vest - S","public_title":"S","options":["S"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":83,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090550"},{"id":30067865481,"title":"M","option1":"M","option2":null,"option3":null,"sku":"FreeStyleBM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353370185,"product_id":8782654921,"position":1,"created_at":"2017-01-31T14:43:53+00:00","updated_at":"2017-01-31T14:43:53+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestbluefront.jpg?v=1485873833","variant_ids":[30067865353,30067865481,30067865545]},"available":true,"name":"Grilla FreeStyle Breathable Vest - M","public_title":"M","options":["M"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":88,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090567"},{"id":30067865545,"title":"L","option1":"L","option2":null,"option3":null,"sku":"FreeStyleBL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353370185,"product_id":8782654921,"position":1,"created_at":"2017-01-31T14:43:53+00:00","updated_at":"2017-01-31T14:43:53+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestbluefront.jpg?v=1485873833","variant_ids":[30067865353,30067865481,30067865545]},"available":true,"name":"Grilla FreeStyle Breathable Vest - L","public_title":"L","options":["L"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":85,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090574"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestbluefront.jpg?v=1485873833","\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestblueback.jpg?v=1485873833"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestbluefront.jpg?v=1485873833","options":["size"],"content":"\u003cp\u003eThe Grilla FreeStyle breathable vest is part of our launch collection. The FreeStyle uses a high quality lightweight performance material which provides support yet figure flattering styling. It feels great to the touch, including breathable mesh panelling on the front and back which is arranged to the contours of the body. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Figure enhancing fit\u003cbr\u003e Light Weight yet high quality fabric\u003cbr\u003e Shell: 92% Polyester 8% Elastane \u003cbr\u003e Panel: 92% Polyester 8% Elastane \u003cbr\u003e \u003cbr\u003e Model is 5,6 and wears small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e"}

Grilla FreeStyle Breathable Vest

£7.00 £14.00

Grilla FreeStyle Breathable Vest

£7.00 £14.00
The Grilla FreeStyle breathable vest is part of our launch collection. The FreeStyle uses a high quality lightweight performance material which provides support yet figure flattering styling. It feels great to the touch, including breathable mesh panelling on the front and back which is arranged to the contours of the...
Sale 50% off
Grilla FreeStyle Breathable Vest Grilla FreeStyle Breathable Vest
{"id":8782655433,"title":"Grilla FreeStyle Breathable Vest","handle":"grilla-freestyle-breathable-vest-pink","description":"\u003cp\u003eThe Grilla FreeStyle breathable vest is part of our launch collection. The FreeStyle uses a high quality lightweight performance material which provides support yet figure flattering styling. It feels great to the touch, including breathable mesh panelling on the front and back which is arranged to the contours of the body. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Figure enhancing fit\u003cbr\u003e Light Weight yet high quality fabric\u003cbr\u003e Shell: 92% Polyester 8% Elastane \u003cbr\u003e Panel: 92% Polyester 8% Elastane\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eModel is 5,6 and wears small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e","published_at":"2017-01-31T14:43:00+00:00","created_at":"2017-01-31T14:44:01+00:00","vendor":"Grilla Clothing","type":"WOMENS","tags":[],"price":700,"price_min":700,"price_max":700,"available":true,"price_varies":false,"compare_at_price":1400,"compare_at_price_min":1400,"compare_at_price_max":1400,"compare_at_price_varies":false,"variants":[{"id":30067867209,"title":"S","option1":"S","option2":null,"option3":null,"sku":"FreeStylePS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353371977,"product_id":8782655433,"position":1,"created_at":"2017-01-31T14:44:02+00:00","updated_at":"2017-01-31T14:44:02+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkfront.jpg?v=1485873842","variant_ids":[30067867209,30067867273,30067867337]},"available":true,"name":"Grilla FreeStyle Breathable Vest - S","public_title":"S","options":["S"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":69,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090529"},{"id":30067867273,"title":"M","option1":"M","option2":null,"option3":null,"sku":"FreeStylePM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353371977,"product_id":8782655433,"position":1,"created_at":"2017-01-31T14:44:02+00:00","updated_at":"2017-01-31T14:44:02+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkfront.jpg?v=1485873842","variant_ids":[30067867209,30067867273,30067867337]},"available":true,"name":"Grilla FreeStyle Breathable Vest - M","public_title":"M","options":["M"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":70,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090536"},{"id":30067867337,"title":"L","option1":"L","option2":null,"option3":null,"sku":"FreeStylePL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353371977,"product_id":8782655433,"position":1,"created_at":"2017-01-31T14:44:02+00:00","updated_at":"2017-01-31T14:44:02+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkfront.jpg?v=1485873842","variant_ids":[30067867209,30067867273,30067867337]},"available":true,"name":"Grilla FreeStyle Breathable Vest - L","public_title":"L","options":["L"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":73,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090543"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkfront.jpg?v=1485873842","\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkback.jpg?v=1485873842","\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkside.jpg?v=1485873842"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkfront.jpg?v=1485873842","options":["size"],"content":"\u003cp\u003eThe Grilla FreeStyle breathable vest is part of our launch collection. The FreeStyle uses a high quality lightweight performance material which provides support yet figure flattering styling. It feels great to the touch, including breathable mesh panelling on the front and back which is arranged to the contours of the body. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Figure enhancing fit\u003cbr\u003e Light Weight yet high quality fabric\u003cbr\u003e Shell: 92% Polyester 8% Elastane \u003cbr\u003e Panel: 92% Polyester 8% Elastane\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eModel is 5,6 and wears small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e"}

Grilla FreeStyle Breathable Vest

£7.00 £14.00

Grilla FreeStyle Breathable Vest

£7.00 £14.00
The Grilla FreeStyle breathable vest is part of our launch collection. The FreeStyle uses a high quality lightweight performance material which provides support yet figure flattering styling. It feels great to the touch, including breathable mesh panelling on the front and back which is arranged to the contours of the...
Sale 50% off
Grilla Squad Hoodie
{"id":8782656457,"title":"Grilla Squad Slim Fit Hoodie","handle":"grilla-squad-slim-fit-hoodie-grey-navy","description":"The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical zipped pockets.\u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Zipped Pockets\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL","published_at":"2017-01-31T14:44:00+00:00","created_at":"2017-01-31T14:44:08+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":1350,"price_min":1350,"price_max":1350,"available":true,"price_varies":false,"compare_at_price":2700,"compare_at_price_min":2700,"compare_at_price_max":2700,"compare_at_price_varies":false,"variants":[{"id":30067873353,"title":"S","option1":"S","option2":null,"option3":null,"sku":"SquadHNS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353375433,"product_id":8782656457,"position":1,"created_at":"2017-01-31T14:44:08+00:00","updated_at":"2017-01-31T14:44:09+00:00","alt":"Grilla Squad Hoodie","width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodienavybluefront_1.jpg?v=1485873849","variant_ids":[30067873353,30067873481,30067873609,30067873801]},"available":true,"name":"Grilla Squad Slim Fit Hoodie - S","public_title":"S","options":["S"],"price":1350,"weight":4000,"compare_at_price":2700,"inventory_quantity":57,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090482"},{"id":30067873481,"title":"M","option1":"M","option2":null,"option3":null,"sku":"SquadHNM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353375433,"product_id":8782656457,"position":1,"created_at":"2017-01-31T14:44:08+00:00","updated_at":"2017-01-31T14:44:09+00:00","alt":"Grilla Squad Hoodie","width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodienavybluefront_1.jpg?v=1485873849","variant_ids":[30067873353,30067873481,30067873609,30067873801]},"available":true,"name":"Grilla Squad Slim Fit Hoodie - M","public_title":"M","options":["M"],"price":1350,"weight":4000,"compare_at_price":2700,"inventory_quantity":18,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090499"},{"id":30067873609,"title":"L","option1":"L","option2":null,"option3":null,"sku":"SquadHNL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353375433,"product_id":8782656457,"position":1,"created_at":"2017-01-31T14:44:08+00:00","updated_at":"2017-01-31T14:44:09+00:00","alt":"Grilla Squad Hoodie","width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodienavybluefront_1.jpg?v=1485873849","variant_ids":[30067873353,30067873481,30067873609,30067873801]},"available":true,"name":"Grilla Squad Slim Fit Hoodie - L","public_title":"L","options":["L"],"price":1350,"weight":4000,"compare_at_price":2700,"inventory_quantity":17,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090505"},{"id":30067873801,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"SquadHNXL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353375433,"product_id":8782656457,"position":1,"created_at":"2017-01-31T14:44:08+00:00","updated_at":"2017-01-31T14:44:09+00:00","alt":"Grilla Squad Hoodie","width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodienavybluefront_1.jpg?v=1485873849","variant_ids":[30067873353,30067873481,30067873609,30067873801]},"available":true,"name":"Grilla Squad Slim Fit Hoodie - XL","public_title":"XL","options":["XL"],"price":1350,"weight":4000,"compare_at_price":2700,"inventory_quantity":15,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090512"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodienavybluefront_1.jpg?v=1485873849"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodienavybluefront_1.jpg?v=1485873849","options":["size"],"content":"The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical zipped pockets.\u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Zipped Pockets\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL"}

Grilla Squad Slim Fit Hoodie

£13.50 £27.00

Grilla Squad Slim Fit Hoodie

£13.50 £27.00
The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include "Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical...
Sale 50% off
Grilla Squad Slim Fit Hoodie Grilla Squad Slim Fit Hoodie
{"id":8782657417,"title":"Grilla Squad Slim Fit Hoodie","handle":"grilla-squad-slim-fit-hoodie-1","description":"The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical zipped pockets.\u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Zipped Pockets\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e 60% Polyester 35% Cotton 5% Elastane","published_at":"2017-01-31T14:44:14+00:00","created_at":"2017-01-31T14:44:18+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":1350,"price_min":1350,"price_max":1350,"available":true,"price_varies":false,"compare_at_price":2700,"compare_at_price_min":2700,"compare_at_price_max":2700,"compare_at_price_varies":false,"variants":[{"id":30067881673,"title":"S","option1":"S","option2":null,"option3":null,"sku":"SquadHBS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353377033,"product_id":8782657417,"position":1,"created_at":"2017-01-31T14:44:18+00:00","updated_at":"2017-01-31T14:44:18+00:00","alt":"Grilla Squad Slim Fit Hoodie","width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodieblackfront.jpg?v=1485873858","variant_ids":[30067881673,30067881737,30067881801,30067881865]},"available":true,"name":"Grilla Squad Slim Fit Hoodie - S","public_title":"S","options":["S"],"price":1350,"weight":4000,"compare_at_price":2700,"inventory_quantity":30,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090444"},{"id":30067881737,"title":"M","option1":"M","option2":null,"option3":null,"sku":"SquadHBM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353377033,"product_id":8782657417,"position":1,"created_at":"2017-01-31T14:44:18+00:00","updated_at":"2017-01-31T14:44:18+00:00","alt":"Grilla Squad Slim Fit Hoodie","width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodieblackfront.jpg?v=1485873858","variant_ids":[30067881673,30067881737,30067881801,30067881865]},"available":true,"name":"Grilla Squad Slim Fit Hoodie - M","public_title":"M","options":["M"],"price":1350,"weight":4000,"compare_at_price":2700,"inventory_quantity":18,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090451"},{"id":30067881801,"title":"L","option1":"L","option2":null,"option3":null,"sku":"SquadHBL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353377033,"product_id":8782657417,"position":1,"created_at":"2017-01-31T14:44:18+00:00","updated_at":"2017-01-31T14:44:18+00:00","alt":"Grilla Squad Slim Fit Hoodie","width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodieblackfront.jpg?v=1485873858","variant_ids":[30067881673,30067881737,30067881801,30067881865]},"available":true,"name":"Grilla Squad Slim Fit Hoodie - L","public_title":"L","options":["L"],"price":1350,"weight":4000,"compare_at_price":2700,"inventory_quantity":9,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090468"},{"id":30067881865,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"SquadHBXL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353377033,"product_id":8782657417,"position":1,"created_at":"2017-01-31T14:44:18+00:00","updated_at":"2017-01-31T14:44:18+00:00","alt":"Grilla Squad Slim Fit Hoodie","width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodieblackfront.jpg?v=1485873858","variant_ids":[30067881673,30067881737,30067881801,30067881865]},"available":true,"name":"Grilla Squad Slim Fit Hoodie - XL","public_title":"XL","options":["XL"],"price":1350,"weight":4000,"compare_at_price":2700,"inventory_quantity":19,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090475"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodieblackfront.jpg?v=1485873858","\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodieblackback.jpg?v=1485873858","\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodieblackside.jpg?v=1485873858","\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodieblackalternative.jpg?v=1485873858"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodieblackfront.jpg?v=1485873858","options":["size"],"content":"The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical zipped pockets.\u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Zipped Pockets\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e 60% Polyester 35% Cotton 5% Elastane"}

Grilla Squad Slim Fit Hoodie

£13.50 £27.00

Grilla Squad Slim Fit Hoodie

£13.50 £27.00
The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include "Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical...
Sale 50% off
Grilla Squad Slim Fit Bottoms Grilla Squad Slim Fit Bottoms
{"id":8782659529,"title":"Grilla Squad Slim Fit Bottoms","handle":"grilla-squad-slim-fit-bottoms-navy","description":"The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped pocket.\u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Reverse Zip Pocket\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e 60% Polyester 35% Cotton 5% Elastane \u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL","published_at":"2017-01-31T14:44:00+00:00","created_at":"2017-01-31T14:44:25+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":1300,"price_min":1300,"price_max":1300,"available":true,"price_varies":false,"compare_at_price":2600,"compare_at_price_min":2600,"compare_at_price_max":2600,"compare_at_price_varies":false,"variants":[{"id":30067887497,"title":"S","option1":"S","option2":null,"option3":null,"sku":"SquadJNS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353378697,"product_id":8782659529,"position":1,"created_at":"2017-01-31T14:44:25+00:00","updated_at":"2017-01-31T14:44:25+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsnavyfront.jpg?v=1485873865","variant_ids":[30067887497,30067887561,30067887625,30067887689]},"available":true,"name":"Grilla Squad Slim Fit Bottoms - S","public_title":"S","options":["S"],"price":1300,"weight":4000,"compare_at_price":2600,"inventory_quantity":37,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090406"},{"id":30067887561,"title":"M","option1":"M","option2":null,"option3":null,"sku":"SquadJNM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353378697,"product_id":8782659529,"position":1,"created_at":"2017-01-31T14:44:25+00:00","updated_at":"2017-01-31T14:44:25+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsnavyfront.jpg?v=1485873865","variant_ids":[30067887497,30067887561,30067887625,30067887689]},"available":true,"name":"Grilla Squad Slim Fit Bottoms - M","public_title":"M","options":["M"],"price":1300,"weight":4000,"compare_at_price":2600,"inventory_quantity":22,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090413"},{"id":30067887625,"title":"L","option1":"L","option2":null,"option3":null,"sku":"SquadJNL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353378697,"product_id":8782659529,"position":1,"created_at":"2017-01-31T14:44:25+00:00","updated_at":"2017-01-31T14:44:25+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsnavyfront.jpg?v=1485873865","variant_ids":[30067887497,30067887561,30067887625,30067887689]},"available":true,"name":"Grilla Squad Slim Fit Bottoms - L","public_title":"L","options":["L"],"price":1300,"weight":4000,"compare_at_price":2600,"inventory_quantity":24,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090420"},{"id":30067887689,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"SquadJNXL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353378697,"product_id":8782659529,"position":1,"created_at":"2017-01-31T14:44:25+00:00","updated_at":"2017-01-31T14:44:25+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsnavyfront.jpg?v=1485873865","variant_ids":[30067887497,30067887561,30067887625,30067887689]},"available":true,"name":"Grilla Squad Slim Fit Bottoms - XL","public_title":"XL","options":["XL"],"price":1300,"weight":4000,"compare_at_price":2600,"inventory_quantity":14,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090437"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsnavyfront.jpg?v=1485873865","\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsnavyback.jpg?v=1485873865"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsnavyfront.jpg?v=1485873865","options":["size"],"content":"The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped pocket.\u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Reverse Zip Pocket\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e 60% Polyester 35% Cotton 5% Elastane \u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL"}

Grilla Squad Slim Fit Bottoms

£13.00 £26.00

Grilla Squad Slim Fit Bottoms

£13.00 £26.00
The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include "Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped...
Sale 50% off
Grilla Squad Slim Fit Bottoms Grilla Squad Slim Fit Bottoms
{"id":8782660681,"title":"Grilla Squad Slim Fit Bottoms","handle":"grilla-squad-slim-fit-bottoms-black","description":"The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped pocket.\u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Reverse Zip Pocket\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL 60% Polyester 35% Cotton 5% Elastane","published_at":"2017-01-31T14:44:00+00:00","created_at":"2017-01-31T14:44:35+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":1300,"price_min":1300,"price_max":1300,"available":true,"price_varies":false,"compare_at_price":2600,"compare_at_price_min":2600,"compare_at_price_max":2600,"compare_at_price_varies":false,"variants":[{"id":30067896841,"title":"S","option1":"S","option2":null,"option3":null,"sku":"SquadJBS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353382537,"product_id":8782660681,"position":1,"created_at":"2017-01-31T14:44:35+00:00","updated_at":"2017-01-31T14:44:35+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackfront.jpg?v=1485873875","variant_ids":[30067896841,30067897033,30067897161,30067897289]},"available":true,"name":"Grilla Squad Slim Fit Bottoms - S","public_title":"S","options":["S"],"price":1300,"weight":4000,"compare_at_price":2600,"inventory_quantity":24,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090369"},{"id":30067897033,"title":"M","option1":"M","option2":null,"option3":null,"sku":"SquadJBM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353382537,"product_id":8782660681,"position":1,"created_at":"2017-01-31T14:44:35+00:00","updated_at":"2017-01-31T14:44:35+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackfront.jpg?v=1485873875","variant_ids":[30067896841,30067897033,30067897161,30067897289]},"available":true,"name":"Grilla Squad Slim Fit Bottoms - M","public_title":"M","options":["M"],"price":1300,"weight":4000,"compare_at_price":2600,"inventory_quantity":12,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090376"},{"id":30067897161,"title":"L","option1":"L","option2":null,"option3":null,"sku":"SquadJBL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353382537,"product_id":8782660681,"position":1,"created_at":"2017-01-31T14:44:35+00:00","updated_at":"2017-01-31T14:44:35+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackfront.jpg?v=1485873875","variant_ids":[30067896841,30067897033,30067897161,30067897289]},"available":true,"name":"Grilla Squad Slim Fit Bottoms - L","public_title":"L","options":["L"],"price":1300,"weight":4000,"compare_at_price":2600,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090383"},{"id":30067897289,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"SquadJBXL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353382537,"product_id":8782660681,"position":1,"created_at":"2017-01-31T14:44:35+00:00","updated_at":"2017-01-31T14:44:35+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackfront.jpg?v=1485873875","variant_ids":[30067896841,30067897033,30067897161,30067897289]},"available":true,"name":"Grilla Squad Slim Fit Bottoms - XL","public_title":"XL","options":["XL"],"price":1300,"weight":4000,"compare_at_price":2600,"inventory_quantity":11,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090390"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackfront.jpg?v=1485873875","\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackback.jpg?v=1485873875","\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackalternative.jpg?v=1485873875","\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackzip2.jpg?v=1485873875","\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackzip.jpg?v=1485873875"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackfront.jpg?v=1485873875","options":["size"],"content":"The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped pocket.\u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Reverse Zip Pocket\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL 60% Polyester 35% Cotton 5% Elastane"}

Grilla Squad Slim Fit Bottoms

£13.00 £26.00

Grilla Squad Slim Fit Bottoms

£13.00 £26.00
The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include "Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped...
Sale 50% off
Grilla Black Out leggings Grilla Black Out leggings
{"id":8782661513,"title":"Grilla Black Out leggings","handle":"grilla-black-out-leggings","description":"\u003cp\u003eOur Black Out Leggings are high waisted and very flattering. These versatile Leggings are a must for your fitness wear collection as they can be worn with most outfits while still looking great. They include a handy rear zipped pocket and some eye catching pink detailing \u003cbr\u003e Key Notes\u003cbr\u003e Great fit\u003cbr\u003e High waisted\u003cbr\u003e Zip Pocket\u003cbr\u003e Body enhancing\u003cbr\u003e Great Design\u003cbr\u003e 92% Polyester 8% Elastane \u003cbr\u003e \u003cbr\u003e Model is 5,6 and wears small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e","published_at":"2017-01-31T14:44:41+00:00","created_at":"2017-01-31T14:44:44+00:00","vendor":"Grilla Clothing","type":"WOMENS","tags":[],"price":900,"price_min":900,"price_max":900,"available":true,"price_varies":false,"compare_at_price":1800,"compare_at_price_min":1800,"compare_at_price_max":1800,"compare_at_price_varies":false,"variants":[{"id":30067902025,"title":"S","option1":"S","option2":null,"option3":null,"sku":"BlackoutS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353386057,"product_id":8782661513,"position":1,"created_at":"2017-01-31T14:44:45+00:00","updated_at":"2017-01-31T14:44:45+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillablackoutleggingspinkfront.jpg?v=1485873885","variant_ids":[30067902025,30067902089,30067902153]},"available":true,"name":"Grilla Black Out leggings - S","public_title":"S","options":["S"],"price":900,"weight":4000,"compare_at_price":1800,"inventory_quantity":30,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090338"},{"id":30067902089,"title":"M","option1":"M","option2":null,"option3":null,"sku":"BlackoutM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353386057,"product_id":8782661513,"position":1,"created_at":"2017-01-31T14:44:45+00:00","updated_at":"2017-01-31T14:44:45+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillablackoutleggingspinkfront.jpg?v=1485873885","variant_ids":[30067902025,30067902089,30067902153]},"available":true,"name":"Grilla Black Out leggings - M","public_title":"M","options":["M"],"price":900,"weight":4000,"compare_at_price":1800,"inventory_quantity":20,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090345"},{"id":30067902153,"title":"L","option1":"L","option2":null,"option3":null,"sku":"BlackoutL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353386057,"product_id":8782661513,"position":1,"created_at":"2017-01-31T14:44:45+00:00","updated_at":"2017-01-31T14:44:45+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillablackoutleggingspinkfront.jpg?v=1485873885","variant_ids":[30067902025,30067902089,30067902153]},"available":true,"name":"Grilla Black Out leggings - L","public_title":"L","options":["L"],"price":900,"weight":4000,"compare_at_price":1800,"inventory_quantity":36,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090352"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillablackoutleggingspinkfront.jpg?v=1485873885","\/\/\/s\/files\/1\/1694\/5867\/products\/grillablackoutleggingspinkback.jpg?v=1485873885","\/\/\/s\/files\/1\/1694\/5867\/products\/grillablackoutleggingspinkbackdetail.jpg?v=1485873885","\/\/\/s\/files\/1\/1694\/5867\/products\/grillablackoutleggingspinkalternative.jpg?v=1485873885"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillablackoutleggingspinkfront.jpg?v=1485873885","options":["size"],"content":"\u003cp\u003eOur Black Out Leggings are high waisted and very flattering. These versatile Leggings are a must for your fitness wear collection as they can be worn with most outfits while still looking great. They include a handy rear zipped pocket and some eye catching pink detailing \u003cbr\u003e Key Notes\u003cbr\u003e Great fit\u003cbr\u003e High waisted\u003cbr\u003e Zip Pocket\u003cbr\u003e Body enhancing\u003cbr\u003e Great Design\u003cbr\u003e 92% Polyester 8% Elastane \u003cbr\u003e \u003cbr\u003e Model is 5,6 and wears small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e"}

Grilla Black Out leggings

£9.00 £18.00

Grilla Black Out leggings

£9.00 £18.00
Our Black Out Leggings are high waisted and very flattering. These versatile Leggings are a must for your fitness wear collection as they can be worn with most outfits while still looking great. They include a handy rear zipped pocket and some eye catching pink detailing Key Notes Great fit...
Sale 50% off
Grilla Pyro Leggings Grilla Pyro Leggings
{"id":8782662601,"title":"Grilla Pyro Leggings","handle":"grilla-pyro-leggings","description":"\u003cp\u003eOur Pryo Leggings are high waisted and very flattering. Make a big statement when you train by wearing these! Our eye catching pyro Leggings are for the bold fitness girls and are certain to gain you many complimentary comments. These high quality, flexible leggings will support you in all the right places. \u003cbr\u003e Key Notes\u003cbr\u003e Great fit\u003cbr\u003e High waisted\u003cbr\u003e Zip Pocket\u003cbr\u003e Body enhancing\u003cbr\u003e Great Design\u003cbr\u003e 92% Polyester 8% Elastane \u003cbr\u003e \u003cbr\u003e Model is 5,6 and wears size small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e","published_at":"2017-01-31T14:44:00+00:00","created_at":"2017-01-31T14:44:54+00:00","vendor":"Grilla Clothing","type":"WOMENS","tags":["Womens Gym Training Apparel"],"price":1000,"price_min":1000,"price_max":1000,"available":true,"price_varies":false,"compare_at_price":2000,"compare_at_price_min":2000,"compare_at_price_max":2000,"compare_at_price_varies":false,"variants":[{"id":30067915593,"title":"S","option1":"S","option2":null,"option3":null,"sku":"PyroS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353390665,"product_id":8782662601,"position":1,"created_at":"2017-01-31T14:44:54+00:00","updated_at":"2017-01-31T14:44:54+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfront.jpg?v=1485873894","variant_ids":[30067915593,30067915657,30067915721]},"available":true,"name":"Grilla Pyro Leggings - S","public_title":"S","options":["S"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":38,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090307"},{"id":30067915657,"title":"M","option1":"M","option2":null,"option3":null,"sku":"PyroM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353390665,"product_id":8782662601,"position":1,"created_at":"2017-01-31T14:44:54+00:00","updated_at":"2017-01-31T14:44:54+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfront.jpg?v=1485873894","variant_ids":[30067915593,30067915657,30067915721]},"available":true,"name":"Grilla Pyro Leggings - M","public_title":"M","options":["M"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":37,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090314"},{"id":30067915721,"title":"L","option1":"L","option2":null,"option3":null,"sku":"PyroL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353390665,"product_id":8782662601,"position":1,"created_at":"2017-01-31T14:44:54+00:00","updated_at":"2017-01-31T14:44:54+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfront.jpg?v=1485873894","variant_ids":[30067915593,30067915657,30067915721]},"available":true,"name":"Grilla Pyro Leggings - L","public_title":"L","options":["L"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":52,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090321"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfront.jpg?v=1485873894","\/\/\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkback.jpg?v=1485873894","\/\/\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfulllength.jpg?v=1485873894","\/\/\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfulllengthback.jpg?v=1485873894"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfront.jpg?v=1485873894","options":["size"],"content":"\u003cp\u003eOur Pryo Leggings are high waisted and very flattering. Make a big statement when you train by wearing these! Our eye catching pyro Leggings are for the bold fitness girls and are certain to gain you many complimentary comments. These high quality, flexible leggings will support you in all the right places. \u003cbr\u003e Key Notes\u003cbr\u003e Great fit\u003cbr\u003e High waisted\u003cbr\u003e Zip Pocket\u003cbr\u003e Body enhancing\u003cbr\u003e Great Design\u003cbr\u003e 92% Polyester 8% Elastane \u003cbr\u003e \u003cbr\u003e Model is 5,6 and wears size small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e"}

Grilla Pyro Leggings

£10.00 £20.00

Grilla Pyro Leggings

£10.00 £20.00
Our Pryo Leggings are high waisted and very flattering. Make a big statement when you train by wearing these! Our eye catching pyro Leggings are for the bold fitness girls and are certain to gain you many complimentary comments. These high quality, flexible leggings will support you in all the...
Sale 50% off
Grilla Squad Tracksuit
{"id":8782663305,"title":"Grilla Squad Tracksuit","handle":"full-grilla-squad-slim-fit-outfit-grey-navy","description":"The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped pocket.\u003cbr\u003e \u003cbr\u003e \u003cbr\u003e \u003cbr\u003e The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical zipped pockets.\u003cbr\u003e \u003cbr\u003e \u003cbr\u003e \u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Reverse Zip Pocket\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL 60% Polyester 35% Cotton 5% Elastane","published_at":"2017-01-31T14:45:00+00:00","created_at":"2017-01-31T14:45:01+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":2750,"price_min":2750,"price_max":2750,"available":true,"price_varies":false,"compare_at_price":5500,"compare_at_price_min":5500,"compare_at_price_max":5500,"compare_at_price_varies":false,"variants":[{"id":30067916681,"title":"S","option1":"S","option2":null,"option3":null,"sku":"FullSquadN-S","requires_shipping":true,"taxable":false,"featured_image":{"id":18353393097,"product_id":8782663305,"position":1,"created_at":"2017-01-31T14:45:01+00:00","updated_at":"2017-01-31T14:45:01+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitgrey.jpg?v=1485873901","variant_ids":[30067916681,31418462665,31418462729,31418462793]},"available":true,"name":"Grilla Squad Tracksuit - S","public_title":"S","options":["S"],"price":2750,"weight":4000,"compare_at_price":5500,"inventory_quantity":197,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090260"},{"id":31418462665,"title":"M","option1":"M","option2":null,"option3":null,"sku":"FullSquadN-M","requires_shipping":true,"taxable":false,"featured_image":{"id":18353393097,"product_id":8782663305,"position":1,"created_at":"2017-01-31T14:45:01+00:00","updated_at":"2017-01-31T14:45:01+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitgrey.jpg?v=1485873901","variant_ids":[30067916681,31418462665,31418462729,31418462793]},"available":true,"name":"Grilla Squad Tracksuit - M","public_title":"M","options":["M"],"price":2750,"weight":4000,"compare_at_price":5500,"inventory_quantity":193,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090277"},{"id":31418462729,"title":"L","option1":"L","option2":null,"option3":null,"sku":"FullSquadN-L","requires_shipping":true,"taxable":false,"featured_image":{"id":18353393097,"product_id":8782663305,"position":1,"created_at":"2017-01-31T14:45:01+00:00","updated_at":"2017-01-31T14:45:01+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitgrey.jpg?v=1485873901","variant_ids":[30067916681,31418462665,31418462729,31418462793]},"available":true,"name":"Grilla Squad Tracksuit - L","public_title":"L","options":["L"],"price":2750,"weight":4000,"compare_at_price":5500,"inventory_quantity":195,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090284"},{"id":31418462793,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"FullSquadN-XL","requires_shipping":true,"taxable":false,"featured_image":{"id":18353393097,"product_id":8782663305,"position":1,"created_at":"2017-01-31T14:45:01+00:00","updated_at":"2017-01-31T14:45:01+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitgrey.jpg?v=1485873901","variant_ids":[30067916681,31418462665,31418462729,31418462793]},"available":true,"name":"Grilla Squad Tracksuit - XL","public_title":"XL","options":["XL"],"price":2750,"weight":4000,"compare_at_price":5500,"inventory_quantity":196,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090291"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitgrey.jpg?v=1485873901"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitgrey.jpg?v=1485873901","options":["Size"],"content":"The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped pocket.\u003cbr\u003e \u003cbr\u003e \u003cbr\u003e \u003cbr\u003e The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical zipped pockets.\u003cbr\u003e \u003cbr\u003e \u003cbr\u003e \u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Reverse Zip Pocket\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL 60% Polyester 35% Cotton 5% Elastane"}

Grilla Squad Tracksuit

£27.50 £55.00

Grilla Squad Tracksuit

£27.50 £55.00
The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include "Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped...
Sale 50% off
Grilla Squad Tracksuit Grilla Squad Tracksuit
{"id":8782663817,"title":"Grilla Squad Tracksuit","handle":"grilla-squad-tracksuit-black","description":"The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped pocket.\u003cbr\u003e \u003cbr\u003e \u003cbr\u003e \u003cbr\u003e The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical zipped pockets.\u003cbr\u003e \u003cbr\u003e \u003cbr\u003e \u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Reverse Zip Pocket\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL 60% Polyester 35% Cotton 5% Elastane","published_at":"2017-01-31T14:45:00+00:00","created_at":"2017-01-31T14:45:06+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":2750,"price_min":2750,"price_max":2750,"available":true,"price_varies":false,"compare_at_price":5500,"compare_at_price_min":5500,"compare_at_price_max":5500,"compare_at_price_varies":false,"variants":[{"id":30067917385,"title":"S","option1":"S","option2":null,"option3":null,"sku":"FullSquadB-S","requires_shipping":true,"taxable":false,"featured_image":{"id":18353394249,"product_id":8782663817,"position":1,"created_at":"2017-01-31T14:45:06+00:00","updated_at":"2017-01-31T14:45:06+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitblackfront.jpg?v=1485873906","variant_ids":[30067917385,31418543753,31418543817,31418543881]},"available":true,"name":"Grilla Squad Tracksuit - S","public_title":"S","options":["S"],"price":2750,"weight":4000,"compare_at_price":5500,"inventory_quantity":193,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090222"},{"id":31418543753,"title":"M","option1":"M","option2":null,"option3":null,"sku":"FullSquadB-M","requires_shipping":true,"taxable":false,"featured_image":{"id":18353394249,"product_id":8782663817,"position":1,"created_at":"2017-01-31T14:45:06+00:00","updated_at":"2017-01-31T14:45:06+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitblackfront.jpg?v=1485873906","variant_ids":[30067917385,31418543753,31418543817,31418543881]},"available":true,"name":"Grilla Squad Tracksuit - M","public_title":"M","options":["M"],"price":2750,"weight":4000,"compare_at_price":5500,"inventory_quantity":190,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090239"},{"id":31418543817,"title":"L","option1":"L","option2":null,"option3":null,"sku":"FullSquadB-L","requires_shipping":true,"taxable":false,"featured_image":{"id":18353394249,"product_id":8782663817,"position":1,"created_at":"2017-01-31T14:45:06+00:00","updated_at":"2017-01-31T14:45:06+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitblackfront.jpg?v=1485873906","variant_ids":[30067917385,31418543753,31418543817,31418543881]},"available":true,"name":"Grilla Squad Tracksuit - L","public_title":"L","options":["L"],"price":2750,"weight":4000,"compare_at_price":5500,"inventory_quantity":194,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090246"},{"id":31418543881,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"FullSquadB-XL","requires_shipping":true,"taxable":false,"featured_image":{"id":18353394249,"product_id":8782663817,"position":1,"created_at":"2017-01-31T14:45:06+00:00","updated_at":"2017-01-31T14:45:06+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitblackfront.jpg?v=1485873906","variant_ids":[30067917385,31418543753,31418543817,31418543881]},"available":true,"name":"Grilla Squad Tracksuit - XL","public_title":"XL","options":["XL"],"price":2750,"weight":4000,"compare_at_price":5500,"inventory_quantity":196,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090253"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitblackfront.jpg?v=1485873906","\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitblackback.jpg?v=1485873906"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitblackfront.jpg?v=1485873906","options":["Size"],"content":"The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped pocket.\u003cbr\u003e \u003cbr\u003e \u003cbr\u003e \u003cbr\u003e The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical zipped pockets.\u003cbr\u003e \u003cbr\u003e \u003cbr\u003e \u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Reverse Zip Pocket\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL 60% Polyester 35% Cotton 5% Elastane"}

Grilla Squad Tracksuit

£27.50 £55.00

Grilla Squad Tracksuit

£27.50 £55.00
The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include "Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped...
Sale 41% off
Burn Blend Diet Vegan Protein Shake
{"id":114885885961,"title":"Burn Blend Diet Vegan Protein Shake","handle":"burn-blend-diet-vegan-protein-shake","description":"\u003c!-- Created with Shogun. --\u003e\n\u003cdiv class=\"shogun-root\" data-shogun-id=\"5a44d38564f65b0037eff3d6\" data-shogun-site-id=\"594a632b-8f27-4fa6-bc19-96f7d437e854\" data-shogun-page-id=\"5a44d38564f65b0037eff3d6\" data-shogun-page-version-id=\"5a4ea1ae24110a004f2927bf\" data-region=\"main\"\u003e\n\u003cdiv id=\"s-05113461-d331-4ebe-a13b-70654a27a245\" class=\"shg-c \"\u003e\n\u003cp\u003eLow Calorie - Low fat - All Green!\u003c\/p\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e","published_at":"2018-01-04T15:44:39+00:00","created_at":"2017-12-15T11:15:14+00:00","vendor":"Grilla Fitness","type":"SUPPLEMENTS,Protein,Featured","tags":[],"price":1900,"price_min":1900,"price_max":1900,"available":true,"price_varies":false,"compare_at_price":3199,"compare_at_price_min":3199,"compare_at_price_max":3199,"compare_at_price_varies":false,"variants":[{"id":1484810354697,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"BBLENDVEGV","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Burn Blend Diet Vegan Protein Shake","public_title":null,"options":["Default Title"],"price":1900,"weight":1130,"compare_at_price":3199,"inventory_quantity":154,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090802"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/VeganVan.png?v=1557915757"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/VeganVan.png?v=1557915757","options":["Title"],"content":"\u003c!-- Created with Shogun. --\u003e\n\u003cdiv class=\"shogun-root\" data-shogun-id=\"5a44d38564f65b0037eff3d6\" data-shogun-site-id=\"594a632b-8f27-4fa6-bc19-96f7d437e854\" data-shogun-page-id=\"5a44d38564f65b0037eff3d6\" data-shogun-page-version-id=\"5a4ea1ae24110a004f2927bf\" data-region=\"main\"\u003e\n\u003cdiv id=\"s-05113461-d331-4ebe-a13b-70654a27a245\" class=\"shg-c \"\u003e\n\u003cp\u003eLow Calorie - Low fat - All Green!\u003c\/p\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e"}

Burn Blend Diet Vegan Protein Shake
Vanilla Essence

£19.00 £31.99

Burn Blend Diet Vegan Protein Shake

£19.00 £31.99
Low Calorie - Low fat - All Green!
Sale 30% off
Levels Pre Workout Levels Pre Workout
{"id":1407836618845,"title":"Levels Pre Workout","handle":"levels-pre-work-out-cola","description":"\u003cmeta charset=\"utf-8\"\u003e\n\u003ch4\u003e\u003cspan style=\"text-decoration: underline;\"\u003eThe next Level in pre-workout supplementation...THERE IS LEVELS TO THIS!\u003c\/span\u003e\u003c\/h4\u003e\n\u003cp\u003eWith our cutting edge pre workout supplement, you can reach your next level!\u003c\/p\u003e\n\u003cp\u003eA culmination of years of testing and development have allowed us to produce what we truly believe is the best pre workout supplement on the market. No cutting corners, no micro-dosing no compromise.\u003c\/p\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eWhat can you expect from Levels?\u003c\/strong\u003e\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cul\u003e\n\u003cli\u003eIncreased Energy without the jitters or crash\u003c\/li\u003e\n\u003cli\u003eLaser like focus\u003c\/li\u003e\n\u003cli\u003eMaximising Cell volume leading to massive pumps\u003c\/li\u003e\n\u003cli\u003eZero Carbs\u003c\/li\u003e\n\u003cli\u003eServing size to allow precision dosage to suit you \u003c\/li\u003e\n\u003cli\u003ePacked with B Vitamins, resulting in optimal delivery of energy and muscle tissue protection. \u003c\/li\u003e\n\u003cli\u003eFour truly exceptional tasting flavours\u003c\/li\u003e\n\u003cli\u003eVegan Friendly\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eNutrition\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003ePer 6.25g (1 Scoop) Serving Contains:\u003cbr\u003eL-Arginine AKG 2:1 1250mg\u003cbr\u003eL-Citruline Malate 1200mg\u003cbr\u003eBeta Alanine 1000mg\u003cbr\u003eL-Taurine 625mg\u003cbr\u003eL-Tyrosine 625mg\u003cbr\u003eCreatine HCL 375mg\u003cbr\u003eD-Glucuronolactone 250mg\u003cbr\u003eCaffeine 125mg\u003cbr\u003ePine Bark Extract 50mg\u003c\/p\u003e\n\u003cp\u003eNiacin 12mg \u003cbr\u003eVitamin B6 1mg\u003cbr\u003eVitamin B12 2.5μg\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eDirections\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eMix 6.25g (1 flat scoop) in 128-150ml of cold water. Shake well and\u003cbr\u003econsume immediately. Advanced users can use up to 2 scoops.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003c\/div\u003e\n\u003cdiv\u003e\u003cspan\u003e\u003c\/span\u003e\u003c\/div\u003e","published_at":"2018-09-10T16:39:22+01:00","created_at":"2018-09-08T14:11:40+01:00","vendor":"Grilla Fitness","type":"SUPPLEMENTS,Featured","tags":[],"price":1960,"price_min":1960,"price_max":1960,"available":true,"price_varies":false,"compare_at_price":2800,"compare_at_price_min":2800,"compare_at_price_max":2800,"compare_at_price_varies":false,"variants":[{"id":12474859585629,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"LevelsCO","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Levels Pre Workout","public_title":null,"options":["Default Title"],"price":1960,"weight":470,"compare_at_price":2800,"inventory_quantity":408,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090918"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/ColaF.jpg?v=1543579195","\/\/\/s\/files\/1\/1694\/5867\/products\/colaR.jpg?v=1543579204"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/ColaF.jpg?v=1543579195","options":["Title"],"content":"\u003cmeta charset=\"utf-8\"\u003e\n\u003ch4\u003e\u003cspan style=\"text-decoration: underline;\"\u003eThe next Level in pre-workout supplementation...THERE IS LEVELS TO THIS!\u003c\/span\u003e\u003c\/h4\u003e\n\u003cp\u003eWith our cutting edge pre workout supplement, you can reach your next level!\u003c\/p\u003e\n\u003cp\u003eA culmination of years of testing and development have allowed us to produce what we truly believe is the best pre workout supplement on the market. No cutting corners, no micro-dosing no compromise.\u003c\/p\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eWhat can you expect from Levels?\u003c\/strong\u003e\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cul\u003e\n\u003cli\u003eIncreased Energy without the jitters or crash\u003c\/li\u003e\n\u003cli\u003eLaser like focus\u003c\/li\u003e\n\u003cli\u003eMaximising Cell volume leading to massive pumps\u003c\/li\u003e\n\u003cli\u003eZero Carbs\u003c\/li\u003e\n\u003cli\u003eServing size to allow precision dosage to suit you \u003c\/li\u003e\n\u003cli\u003ePacked with B Vitamins, resulting in optimal delivery of energy and muscle tissue protection. \u003c\/li\u003e\n\u003cli\u003eFour truly exceptional tasting flavours\u003c\/li\u003e\n\u003cli\u003eVegan Friendly\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eNutrition\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003ePer 6.25g (1 Scoop) Serving Contains:\u003cbr\u003eL-Arginine AKG 2:1 1250mg\u003cbr\u003eL-Citruline Malate 1200mg\u003cbr\u003eBeta Alanine 1000mg\u003cbr\u003eL-Taurine 625mg\u003cbr\u003eL-Tyrosine 625mg\u003cbr\u003eCreatine HCL 375mg\u003cbr\u003eD-Glucuronolactone 250mg\u003cbr\u003eCaffeine 125mg\u003cbr\u003ePine Bark Extract 50mg\u003c\/p\u003e\n\u003cp\u003eNiacin 12mg \u003cbr\u003eVitamin B6 1mg\u003cbr\u003eVitamin B12 2.5μg\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eDirections\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eMix 6.25g (1 flat scoop) in 128-150ml of cold water. Shake well and\u003cbr\u003econsume immediately. Advanced users can use up to 2 scoops.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003c\/div\u003e\n\u003cdiv\u003e\u003cspan\u003e\u003c\/span\u003e\u003c\/div\u003e"}

Levels Pre Workout

£19.60 £28.00

Levels Pre Workout

£19.60 £28.00
The next Level in pre-workout supplementation...THERE IS LEVELS TO THIS! With our cutting edge pre workout supplement, you can reach your next level! A culmination of years of testing and development have allowed us to produce what we truly believe is the best pre workout supplement on the market. No...
Sale 30% off
Levels Pre Workout Levels Pre Workout
{"id":1407844253789,"title":"Levels Pre Workout","handle":"levels-pre-workout-orange-passion-fruit","description":"\u003cmeta charset=\"utf-8\"\u003e\n\u003ch4\u003e\u003cspan style=\"text-decoration: underline;\"\u003eThe next Level in pre-workout supplementation...THERE IS LEVELS TO THIS!\u003c\/span\u003e\u003c\/h4\u003e\n\u003cp\u003eWith our cutting edge pre workout supplement, you can reach your next level!\u003c\/p\u003e\n\u003cp\u003eA culmination of years of testing and development have allowed us to produce what we truly believe is the best pre workout supplement on the market. No cutting corners, no micro-dosing no compromise.\u003c\/p\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eWhat can you expect from Levels?\u003c\/strong\u003e\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cul\u003e\n\u003cli\u003eIncreased Energy without the jitters or crash\u003c\/li\u003e\n\u003cli\u003eLaser like focus\u003c\/li\u003e\n\u003cli\u003eMaximising Cell volume leading to massive pumps\u003c\/li\u003e\n\u003cli\u003eZero Carbs\u003c\/li\u003e\n\u003cli\u003eServing size to allow precision dosage to suit you \u003c\/li\u003e\n\u003cli\u003ePacked with B Vitamins, resulting in optimal delivery of energy and muscle tissue protection. \u003c\/li\u003e\n\u003cli\u003eFour truly exceptional tasting flavours\u003c\/li\u003e\n\u003cli\u003eVegan Friendly\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eNutrition\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003ePer 6.25g (1 Scoop) Serving Contains:\u003cbr\u003eL-Arginine AKG 2:1 1250mg\u003cbr\u003eL-Citruline Malate 1200mg\u003cbr\u003eBeta Alanine 1000mg\u003cbr\u003eL-Taurine 625mg\u003cbr\u003eL-Tyrosine 625mg\u003cbr\u003eCreatine HCL 375mg\u003cbr\u003eD-Glucuronolactone 250mg\u003cbr\u003eCaffeine 125mg\u003cbr\u003ePine Bark Extract 50mg\u003c\/p\u003e\n\u003cp\u003eNiacin 12mg \u003cbr\u003eVitamin B6 1mg\u003cbr\u003eVitamin B12 2.5μg\u003c\/p\u003e\n\u003cp\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eDirections\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eMix 6.25g (1 flat scoop) in 128-150ml of cold water. Shake well and\u003cbr\u003econsume immediately. Advanced users can use up to 2 scoops.\u003c\/p\u003e\n\u003c\/div\u003e","published_at":"2018-09-10T16:59:29+01:00","created_at":"2018-09-08T14:27:26+01:00","vendor":"Grilla Fitness","type":"SUPPLEMENTS,Featured","tags":[],"price":1960,"price_min":1960,"price_max":1960,"available":true,"price_varies":false,"compare_at_price":2800,"compare_at_price_min":2800,"compare_at_price_max":2800,"compare_at_price_varies":false,"variants":[{"id":12474881081437,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"LevelsOR","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Levels Pre Workout","public_title":null,"options":["Default Title"],"price":1960,"weight":470,"compare_at_price":2800,"inventory_quantity":443,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090925"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/OrangeF.jpg?v=1543579421","\/\/\/s\/files\/1\/1694\/5867\/products\/OrangeB.jpg?v=1543579430"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/OrangeF.jpg?v=1543579421","options":["Title"],"content":"\u003cmeta charset=\"utf-8\"\u003e\n\u003ch4\u003e\u003cspan style=\"text-decoration: underline;\"\u003eThe next Level in pre-workout supplementation...THERE IS LEVELS TO THIS!\u003c\/span\u003e\u003c\/h4\u003e\n\u003cp\u003eWith our cutting edge pre workout supplement, you can reach your next level!\u003c\/p\u003e\n\u003cp\u003eA culmination of years of testing and development have allowed us to produce what we truly believe is the best pre workout supplement on the market. No cutting corners, no micro-dosing no compromise.\u003c\/p\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eWhat can you expect from Levels?\u003c\/strong\u003e\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cul\u003e\n\u003cli\u003eIncreased Energy without the jitters or crash\u003c\/li\u003e\n\u003cli\u003eLaser like focus\u003c\/li\u003e\n\u003cli\u003eMaximising Cell volume leading to massive pumps\u003c\/li\u003e\n\u003cli\u003eZero Carbs\u003c\/li\u003e\n\u003cli\u003eServing size to allow precision dosage to suit you \u003c\/li\u003e\n\u003cli\u003ePacked with B Vitamins, resulting in optimal delivery of energy and muscle tissue protection. \u003c\/li\u003e\n\u003cli\u003eFour truly exceptional tasting flavours\u003c\/li\u003e\n\u003cli\u003eVegan Friendly\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eNutrition\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003ePer 6.25g (1 Scoop) Serving Contains:\u003cbr\u003eL-Arginine AKG 2:1 1250mg\u003cbr\u003eL-Citruline Malate 1200mg\u003cbr\u003eBeta Alanine 1000mg\u003cbr\u003eL-Taurine 625mg\u003cbr\u003eL-Tyrosine 625mg\u003cbr\u003eCreatine HCL 375mg\u003cbr\u003eD-Glucuronolactone 250mg\u003cbr\u003eCaffeine 125mg\u003cbr\u003ePine Bark Extract 50mg\u003c\/p\u003e\n\u003cp\u003eNiacin 12mg \u003cbr\u003eVitamin B6 1mg\u003cbr\u003eVitamin B12 2.5μg\u003c\/p\u003e\n\u003cp\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eDirections\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eMix 6.25g (1 flat scoop) in 128-150ml of cold water. Shake well and\u003cbr\u003econsume immediately. Advanced users can use up to 2 scoops.\u003c\/p\u003e\n\u003c\/div\u003e"}

Levels Pre Workout
Orange & Passion Fruit

£19.60 £28.00

Levels Pre Workout

£19.60 £28.00
The next Level in pre-workout supplementation...THERE IS LEVELS TO THIS! With our cutting edge pre workout supplement, you can reach your next level! A culmination of years of testing and development have allowed us to produce what we truly believe is the best pre workout supplement on the market. No...
Sale 30% off
Levels Pre Workout Levels Pre Workout
{"id":1407845761117,"title":"Levels Pre Workout","handle":"levels-pre-workout-blue-raspberry","description":"\u003cmeta charset=\"utf-8\"\u003e\n\u003ch4\u003e\u003cspan style=\"text-decoration: underline;\"\u003eThe next Level in pre-workout supplementation...THERE IS LEVELS TO THIS!\u003c\/span\u003e\u003c\/h4\u003e\n\u003cp\u003eWith our cutting edge pre workout supplement, you can reach your next level!\u003c\/p\u003e\n\u003cp\u003eA culmination of years of testing and development have allowed us to produce what we truly believe is the best pre workout supplement on the market. No cutting corners, no micro-dosing no compromise.\u003c\/p\u003e\n\u003cdiv\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eWhat can you expect from Levels?\u003c\/strong\u003e\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cul\u003e\n\u003cli\u003eIncreased Energy without the jitters or crash\u003c\/li\u003e\n\u003cli\u003eLaser like focus\u003c\/li\u003e\n\u003cli\u003eMaximising Cell volume leading to massive pumps\u003c\/li\u003e\n\u003cli\u003eZero Carbs\u003c\/li\u003e\n\u003cli\u003eServing size to allow precision dosage to suit you \u003c\/li\u003e\n\u003cli\u003ePacked with B Vitamins, resulting in optimal delivery of energy and muscle tissue protection. \u003c\/li\u003e\n\u003cli\u003eFour truly exceptional tasting flavours\u003c\/li\u003e\n\u003cli\u003eVegan Friendly\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eNutrition\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003ePer 6.25g (1 Scoop) Serving Contains:\u003cbr\u003eL-Arginine AKG 2:1 1250mg\u003cbr\u003eL-Citruline Malate 1200mg\u003cbr\u003eBeta Alanine 1000mg\u003cbr\u003eL-Taurine 625mg\u003cbr\u003eL-Tyrosine 625mg\u003cbr\u003eCreatine HCL 375mg\u003cbr\u003eD-Glucuronolactone 250mg\u003cbr\u003eCaffeine 125mg\u003cbr\u003ePine Bark Extract 50mg\u003c\/p\u003e\n\u003cp\u003eNiacin 12mg \u003cbr\u003eVitamin B6 1mg\u003cbr\u003eVitamin B12 2.5μg\u003c\/p\u003e\n\u003cp\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eDirections\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eMix 6.25g (1 flat scoop) in 128-150ml of cold water. Shake well and\u003cbr\u003econsume immediately. Advanced users can use up to 2 scoops.\u003c\/p\u003e\n\u003c\/div\u003e","published_at":"2018-09-10T16:56:58+01:00","created_at":"2018-09-08T14:31:29+01:00","vendor":"Grilla Fitness","type":"SUPPLEMENTS,Featured","tags":[],"price":1960,"price_min":1960,"price_max":1960,"available":true,"price_varies":false,"compare_at_price":2800,"compare_at_price_min":2800,"compare_at_price_max":2800,"compare_at_price_varies":false,"variants":[{"id":12474887929949,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"LevelsBR","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Levels Pre Workout","public_title":null,"options":["Default Title"],"price":1960,"weight":470,"compare_at_price":2800,"inventory_quantity":383,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090895"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/BlueRF.jpg?v=1543579147","\/\/\/s\/files\/1\/1694\/5867\/products\/BlueRB.jpg?v=1543579158"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/BlueRF.jpg?v=1543579147","options":["Title"],"content":"\u003cmeta charset=\"utf-8\"\u003e\n\u003ch4\u003e\u003cspan style=\"text-decoration: underline;\"\u003eThe next Level in pre-workout supplementation...THERE IS LEVELS TO THIS!\u003c\/span\u003e\u003c\/h4\u003e\n\u003cp\u003eWith our cutting edge pre workout supplement, you can reach your next level!\u003c\/p\u003e\n\u003cp\u003eA culmination of years of testing and development have allowed us to produce what we truly believe is the best pre workout supplement on the market. No cutting corners, no micro-dosing no compromise.\u003c\/p\u003e\n\u003cdiv\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eWhat can you expect from Levels?\u003c\/strong\u003e\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cul\u003e\n\u003cli\u003eIncreased Energy without the jitters or crash\u003c\/li\u003e\n\u003cli\u003eLaser like focus\u003c\/li\u003e\n\u003cli\u003eMaximising Cell volume leading to massive pumps\u003c\/li\u003e\n\u003cli\u003eZero Carbs\u003c\/li\u003e\n\u003cli\u003eServing size to allow precision dosage to suit you \u003c\/li\u003e\n\u003cli\u003ePacked with B Vitamins, resulting in optimal delivery of energy and muscle tissue protection. \u003c\/li\u003e\n\u003cli\u003eFour truly exceptional tasting flavours\u003c\/li\u003e\n\u003cli\u003eVegan Friendly\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eNutrition\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003ePer 6.25g (1 Scoop) Serving Contains:\u003cbr\u003eL-Arginine AKG 2:1 1250mg\u003cbr\u003eL-Citruline Malate 1200mg\u003cbr\u003eBeta Alanine 1000mg\u003cbr\u003eL-Taurine 625mg\u003cbr\u003eL-Tyrosine 625mg\u003cbr\u003eCreatine HCL 375mg\u003cbr\u003eD-Glucuronolactone 250mg\u003cbr\u003eCaffeine 125mg\u003cbr\u003ePine Bark Extract 50mg\u003c\/p\u003e\n\u003cp\u003eNiacin 12mg \u003cbr\u003eVitamin B6 1mg\u003cbr\u003eVitamin B12 2.5μg\u003c\/p\u003e\n\u003cp\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eDirections\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eMix 6.25g (1 flat scoop) in 128-150ml of cold water. Shake well and\u003cbr\u003econsume immediately. Advanced users can use up to 2 scoops.\u003c\/p\u003e\n\u003c\/div\u003e"}

Levels Pre Workout
Blue Raspberry

£19.60 £28.00

Levels Pre Workout

£19.60 £28.00
The next Level in pre-workout supplementation...THERE IS LEVELS TO THIS! With our cutting edge pre workout supplement, you can reach your next level! A culmination of years of testing and development have allowed us to produce what we truly believe is the best pre workout supplement on the market. No...
Sale 30% off
Levels Pre Workout Levels Pre Workout
{"id":1407848054877,"title":"Levels Pre Workout","handle":"levels-pre-workout-green-apple","description":"\u003cmeta charset=\"utf-8\"\u003e\n\u003ch4\u003e\u003cspan style=\"text-decoration: underline;\"\u003eThe next Level in pre-workout supplementation...THERE IS LEVELS TO THIS!\u003c\/span\u003e\u003c\/h4\u003e\n\u003cp\u003eWith our cutting edge pre workout supplement, you can reach your next level!\u003c\/p\u003e\n\u003cp\u003eA culmination of years of testing and development have allowed us to produce what we truly believe is the best pre workout supplement on the market. No cutting corners, no micro-dosing no compromise.\u003c\/p\u003e\n\u003cdiv\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eWhat can you expect from Levels?\u003c\/strong\u003e\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cul\u003e\n\u003cli\u003eIncreased Energy without the jitters or crash\u003c\/li\u003e\n\u003cli\u003eLaser like focus\u003c\/li\u003e\n\u003cli\u003eMaximising Cell volume leading to massive pumps\u003c\/li\u003e\n\u003cli\u003eZero Carbs\u003c\/li\u003e\n\u003cli\u003eServing size to allow precision dosage to suit you \u003c\/li\u003e\n\u003cli\u003ePacked with B Vitamins, resulting in optimal delivery of energy and muscle tissue protection. \u003c\/li\u003e\n\u003cli\u003eFour truly exceptional tasting flavours\u003c\/li\u003e\n\u003cli\u003eVegan Friendly\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eNutrition\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003ePer 6.25g (1 Scoop) Serving Contains:\u003cbr\u003eL-Arginine AKG 2:1 1250mg\u003cbr\u003eL-Citruline Malate 1200mg\u003cbr\u003eBeta Alanine 1000mg\u003cbr\u003eL-Taurine 625mg\u003cbr\u003eL-Tyrosine 625mg\u003cbr\u003eCreatine HCL 375mg\u003cbr\u003eD-Glucuronolactone 250mg\u003cbr\u003eCaffeine 125mg\u003cbr\u003ePine Bark Extract 50mg\u003c\/p\u003e\n\u003cp\u003eNiacin 12mg \u003cbr\u003eVitamin B6 1mg\u003cbr\u003eVitamin B12 2.5μg\u003c\/p\u003e\n\u003cp\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eDirections\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eMix 6.25g (1 flat scoop) in 128-150ml of cold water. Shake well and\u003cbr\u003econsume immediately. Advanced users can use up to 2 scoops.\u003c\/p\u003e\n\u003c\/div\u003e","published_at":"2018-09-10T16:58:44+01:00","created_at":"2018-09-08T14:37:19+01:00","vendor":"Grilla Fitness","type":"SUPPLEMENTS,Featured","tags":[],"price":1960,"price_min":1960,"price_max":1960,"available":true,"price_varies":false,"compare_at_price":2800,"compare_at_price_min":2800,"compare_at_price_max":2800,"compare_at_price_varies":false,"variants":[{"id":12474895269981,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"LevelsGA","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Levels Pre Workout","public_title":null,"options":["Default Title"],"price":1960,"weight":470,"compare_at_price":2800,"inventory_quantity":429,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090901"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/appleF.jpg?v=1543579349","\/\/\/s\/files\/1\/1694\/5867\/products\/appleR.jpg?v=1543579360"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/appleF.jpg?v=1543579349","options":["Title"],"content":"\u003cmeta charset=\"utf-8\"\u003e\n\u003ch4\u003e\u003cspan style=\"text-decoration: underline;\"\u003eThe next Level in pre-workout supplementation...THERE IS LEVELS TO THIS!\u003c\/span\u003e\u003c\/h4\u003e\n\u003cp\u003eWith our cutting edge pre workout supplement, you can reach your next level!\u003c\/p\u003e\n\u003cp\u003eA culmination of years of testing and development have allowed us to produce what we truly believe is the best pre workout supplement on the market. No cutting corners, no micro-dosing no compromise.\u003c\/p\u003e\n\u003cdiv\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eWhat can you expect from Levels?\u003c\/strong\u003e\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cul\u003e\n\u003cli\u003eIncreased Energy without the jitters or crash\u003c\/li\u003e\n\u003cli\u003eLaser like focus\u003c\/li\u003e\n\u003cli\u003eMaximising Cell volume leading to massive pumps\u003c\/li\u003e\n\u003cli\u003eZero Carbs\u003c\/li\u003e\n\u003cli\u003eServing size to allow precision dosage to suit you \u003c\/li\u003e\n\u003cli\u003ePacked with B Vitamins, resulting in optimal delivery of energy and muscle tissue protection. \u003c\/li\u003e\n\u003cli\u003eFour truly exceptional tasting flavours\u003c\/li\u003e\n\u003cli\u003eVegan Friendly\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eNutrition\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003ePer 6.25g (1 Scoop) Serving Contains:\u003cbr\u003eL-Arginine AKG 2:1 1250mg\u003cbr\u003eL-Citruline Malate 1200mg\u003cbr\u003eBeta Alanine 1000mg\u003cbr\u003eL-Taurine 625mg\u003cbr\u003eL-Tyrosine 625mg\u003cbr\u003eCreatine HCL 375mg\u003cbr\u003eD-Glucuronolactone 250mg\u003cbr\u003eCaffeine 125mg\u003cbr\u003ePine Bark Extract 50mg\u003c\/p\u003e\n\u003cp\u003eNiacin 12mg \u003cbr\u003eVitamin B6 1mg\u003cbr\u003eVitamin B12 2.5μg\u003c\/p\u003e\n\u003cp\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eDirections\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eMix 6.25g (1 flat scoop) in 128-150ml of cold water. Shake well and\u003cbr\u003econsume immediately. Advanced users can use up to 2 scoops.\u003c\/p\u003e\n\u003c\/div\u003e"}

Levels Pre Workout
Green Apple

£19.60 £28.00

Levels Pre Workout

£19.60 £28.00
The next Level in pre-workout supplementation...THERE IS LEVELS TO THIS! With our cutting edge pre workout supplement, you can reach your next level! A culmination of years of testing and development have allowed us to produce what we truly believe is the best pre workout supplement on the market. No...
Sale 30% off
Whey Isoblend Whey Isoblend
{"id":1581160398941,"title":"Whey Isoblend","handle":"whey-isoblend-chocolate-chunk","description":"\u003cp\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eWho is Isoblend for?\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eIsoblend is for those looking to tone, sculpt and build lean muscle mass. When training, Protein intake is essential to muscle growth and recovery. It can however, be very hard to obtain the correct amount of protein purely through food, which is why supplementing your diet with Isoblend can greatly improve muscle growth and recovery.  It is suitable for both men and women aiming to support their gym, sport or exercise activities\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003eAround 82% protein\u003c\/li\u003e\n\u003cli\u003eUltra high quality whey isolate content\u003c\/li\u003e\n\u003cli\u003eUltra Low calories, 116 per serving\u003c\/li\u003e\n\u003cli\u003eOnly 1.6g of carbs per serving\u003c\/li\u003e\n\u003cli\u003eWhey protein sourced from grass fed cows\u003c\/li\u003e\n\u003cli\u003eNon GMO\u003c\/li\u003e\n\u003cli\u003eNo added Gluten\u003c\/li\u003e\n\u003cli\u003eVegetarian Friendly\u003c\/li\u003e\n\u003cli\u003eAdded digestive enzymes to help break down nutrients\u003c\/li\u003e\n\u003cli\u003eIncredible taste!\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eNutrition\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003e                                   \u003cspan style=\"text-decoration: underline;\"\u003e\u003cspan\u003e Per 100g    Per 30g Portion   %RI* \u003c\/span\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cdiv\u003eEnergy (kj\/kcal)            1618\/387    485\/116                6% \u003c\/div\u003e\n\u003cdiv\u003eFat (g)                           4.3             1.3                        2% \u003c\/div\u003e\n\u003cdiv\u003eof which saturates (g)   2.7             0.8                        4% \u003c\/div\u003e\n\u003cdiv\u003eCarbohydrate (g)          5.4             1.6                        1% \u003c\/div\u003e\n\u003cdiv\u003eof which sugar (g)         3.5             1.0                        1% \u003c\/div\u003e\n\u003cdiv\u003eFibre (g)                        0.9             0.3 \u003c\/div\u003e\n\u003cdiv\u003eProtein (g)                    81.7            24.5                       49%\u003c\/div\u003e\n\u003cdiv\u003eSalt (g)                         0.4              0.1                         2%\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cdiv\u003e\n\u003cdiv\u003e\n\u003cspan style=\"text-decoration: underline;\"\u003eAmino Acid\u003c\/span\u003e                 \u003cspan style=\"text-decoration: underline;\"\u003ePer 100g      Per 30g\u003c\/span\u003e\n\u003c\/div\u003e\n\u003cdiv\u003eLeucine (g)                    7.0               2.1\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv\u003eIsoleucine (g)                 3.8               1.1\u003c\/div\u003e\n\u003cdiv\u003eValine (g)                       3.8               1.1\u003c\/div\u003e\n\u003cdiv\u003eAspartic Acid (g)            7.2               2.1\u003c\/div\u003e\n\u003cdiv\u003eGlutamic Acid (g)          11.5              3.4\u003c\/div\u003e\n\u003cdiv\u003eSerine (g)                       3.6              1.1\u003c\/div\u003e\n\u003cdiv\u003eGlycine (g)                     8.1               2.4\u003c\/div\u003e\n\u003cdiv\u003eHistidine (g)                   1.2               0.4\u003c\/div\u003e\n\u003cdiv\u003eArginine (g)                    1.8               0.5\u003c\/div\u003e\n\u003cdiv\u003eThreonine (g)                 4.9               1.5\u003c\/div\u003e\n\u003cdiv\u003eAlanine (g)                     5.9               1.8\u003c\/div\u003e\n\u003cdiv\u003eProline (g)                      3.8               1.1\u003c\/div\u003e\n\u003cdiv\u003eTyrosine (g)                    2.0               0.6\u003c\/div\u003e\n\u003cdiv\u003eMethionine (g)                1.2               0.4\u003c\/div\u003e\n\u003cdiv\u003eCystine (g)                     1.6               0.5\u003c\/div\u003e\n\u003cdiv\u003ePhenylalanine (g)           2.2              0.6\u003c\/div\u003e\n\u003cdiv\u003eLysine (g)                       11.3             3.4\u003c\/div\u003e\n\u003cdiv\u003eTryptophan (g)                0.9              0.3\u003c\/div\u003e\n\u003cdiv\u003eTotal                                81.7            25\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003c\/span\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003c\/span\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eIngredients\u003c\/span\u003e\u003c\/strong\u003e\u003cbr\u003eWhey Protein Concentrate (Contains Emulsifier: Soya Lecithin) (Milk), Whey Protein Isolate (Milk), Whey Protein Hydrolysate (Milk), Flavouring, Thickener(Cellulose Gum), Digezyme Enzyme Complex (Alpha-Amylase, Neutral Protease, Lactase, Lipase, Cellulase), Sweeteners (Acesulfame Potassium, Sucralose).\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003ePreparation Instructions\u003c\/strong\u003e\u003c\/span\u003e\u003cbr\u003eAdd one scoop to 200ml of cold water in a shaker, fully skimmed milk, nut milk such as almond milk\/coconut milk. Shake well.\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003ch2\u003e\u003c\/h2\u003e","published_at":"2018-12-05T16:08:17+00:00","created_at":"2018-11-27T16:03:00+00:00","vendor":"Grilla Fitness","type":"SUPPLEMENTS","tags":[],"price":1820,"price_min":1820,"price_max":1820,"available":true,"price_varies":false,"compare_at_price":2600,"compare_at_price_min":2600,"compare_at_price_max":2600,"compare_at_price_varies":false,"variants":[{"id":15452142010461,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ISOBLCC","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Whey Isoblend","public_title":null,"options":["Default Title"],"price":1820,"weight":1130,"compare_at_price":2600,"inventory_quantity":275,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090864"}],"images":["\/\/\/s\/files\/1\/1694\/5867\/products\/chocclearF.jpg?v=1543576031","\/\/\/s\/files\/1\/1694\/5867\/products\/ChocclearB.jpg?v=1543576044"],"featured_image":"\/\/\/s\/files\/1\/1694\/5867\/products\/chocclearF.jpg?v=1543576031","options":["Title"],"content":"\u003cp\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eWho is Isoblend for?\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eIsoblend is for those looking to tone, sculpt and build lean muscle mass. When training, Protein intake is essential to muscle growth and recovery. It can however, be very hard to obtain the correct amount of protein purely through food, which is why supplementing your diet with Isoblend can greatly improve muscle growth and recovery.  It is suitable for both men and women aiming to support their gym, sport or exercise activities\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003eAround 82% protein\u003c\/li\u003e\n\u003cli\u003eUltra high quality whey isolate content\u003c\/li\u003e\n\u003cli\u003eUltra Low calories, 116 per serving\u003c\/li\u003e\n\u003cli\u003eOnly 1.6g of carbs per serving\u003c\/li\u003e\n\u003cli\u003eWhey protein sourced from grass fed cows\u003c\/li\u003e\n\u003cli\u003eNon GMO\u003c\/li\u003e\n\u003cli\u003eNo added Gluten\u003c\/li\u003e\n\u003cli\u003eVegetarian Friendly\u003c\/li\u003e\n\u003cli\u003eAdded digestive enzymes to help break down nutrients\u003c\/li\u003e\n\u003cli\u003eIncredible taste!\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eNutrition\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003e                                   \u003cspan style=\"text-decoration: underline;\"\u003e\u003cspan\u003e Per 100g    Per 30g Portion   %RI* \u003c\/span\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cdiv\u003eEnergy (kj\/kcal)            1618\/387    485\/116                6% \u003c\/div\u003e\n\u003cdiv\u003eFat (g)                           4.3             1.3                        2% \u003c\/div\u003e\n\u003cdiv\u003eof which saturates (g)   2.7             0.8                        4% \u003c\/div\u003e\n\u003cdiv\u003eCarbohydrate (g)          5.4             1.6                        1% \u003c\/div\u003e\n\u003cdiv\u003eof which sugar (g)         3.5             1.0                        1% \u003c\/div\u003e\n\u003cdiv\u003eFibre (g)                        0.9             0.3 \u003c\/div\u003e\n\u003cdiv\u003eProtein (g)                    81.7            24.5                       49%\u003c\/div\u003e\n\u003cdiv\u003eSalt (g)                         0.4              0.1                         2%\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cdiv\u003e\n\u003cdiv\u003e\n\u003cspan style=\"text-decoration: underline;\"\u003eAmino Acid\u003c\/span\u003e                 \u003cspan style=\"text-decoration: underline;\"\u003ePer 100g      Per 30g\u003c\/span\u003e\n\u003c\/div\u003e\n\u003cdiv\u003eLeucine (g)                    7.0               2.1\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv\u003eIsoleucine (g)                 3.8               1.1\u003c\/div\u003e\n\u003cdiv\u003eValine (g)                       3.8               1.1\u003c\/div\u003e\n\u003cdiv\u003eAspartic Acid (g)            7.2               2.1\u003c\/div\u003e\n\u003cdiv\u003eGlutamic Acid (g)          11.5              3.4\u003c\/div\u003e\n\u003cdiv\u003eSerine (g)                       3.6              1.1\u003c\/div\u003e\n\u003cdiv\u003eGlycine (g)                     8.1               2.4\u003c\/div\u003e\n\u003cdiv\u003eHistidine (g)                   1.2               0.4\u003c\/div\u003e\n\u003cdiv\u003eArginine (g)                    1.8               0.5\u003c\/div\u003e\n\u003cdiv\u003eThreonine (g)                 4.9               1.5\u003c\/div\u003e\n\u003cdiv\u003eAlanine (g)                     5.9               1.8\u003c\/div\u003e\n\u003cdiv\u003eProline (g)                      3.8               1.1\u003c\/div\u003e\n\u003cdiv\u003eTyrosine (g)                    2.0               0.6\u003c\/div\u003e\n\u003cdiv\u003eMethionine (g)                1.2               0.4\u003c\/div\u003e\n\u003cdiv\u003eCystine (g)                     1.6               0.5\u003c\/div\u003e\n\u003cdiv\u003ePhenylalanine (g)           2.2              0.6\u003c\/div\u003e\n\u003cdiv\u003eLysine (g)                       11.3             3.4\u003c\/div\u003e\n\u003cdiv\u003eTryptophan (g)                0.9              0.3\u003c\/div\u003e\n\u003cdiv\u003eTotal                                81.7            25\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003c\/span\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003c\/span\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eIngredients\u003c\/span\u003e\u003c\/strong\u003e\u003cbr\u003eWhey Protein Concentrate (Contains Emulsifier: Soya Lecithin) (Milk), Whey Protein Isolate (Milk), Whey Protein Hydrolysate (Milk), Flavouring, Thickener(Cellulose Gum), Digezyme Enzyme Complex (Alpha-Amylase, Neutral Protease, Lactase, Lipase, Cellulase), Sweeteners (Acesulfame Potassium, Sucralose).\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003ePreparation Instructions\u003c\/strong\u003e\u003c\/span\u003e\u003cbr\u003eAdd one scoop to 200ml of cold water in a shaker, fully skimmed milk, nut milk such as almond milk\/coconut milk. Shake well.\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003ch2\u003e\u003c\/h2\u003e"}

Whey Isoblend
Chocolate Chunk

£18.20 £26.00

Whey Isoblend

£18.20 £26.00
Who is Isoblend for? Isoblend is for those looking to tone, sculpt and build lean muscle mass. When training, Protein intake is essential to muscle growth and recovery. It can however, be very hard to obtain the correct amount of protein purely through food, which is why supplementing your diet...