Products

Burn Blend Diet Protein Shake Peanut Chocotini
{"id":8896775689,"title":"Burn Blend Diet Protein Shake Peanut Chocotini","handle":"grilla-burn-blend-diet-protein-shake-peanut-chocotini","description":"\u003c!-- Created with Shogun. --\u003e\n\n\u003cdiv class=\"shogun-root\" data-shogun-id=\"5d6929e22959d4004fa52248\" data-shogun-site-id=\"594a632b-8f27-4fa6-bc19-96f7d437e854\" data-shogun-page-id=\"5d6929e22959d4004fa52248\" data-shogun-page-version-id=\"5d972578bc3c8f005dc5322e\" data-shogun-platform-type=\"shopify\" data-shogun-variant-id=\"5d972578bc3c8f005dc53450\" data-region=\"main\"\u003e\n \n\n\u003cdiv id=\"s-932b5205-1234-469a-880b-7cae49ec0c71\" class=\"shg-c \"\u003e\n \u003cdiv class=\"shg-rich-text shg-theme-text-content\"\u003e\u003cp\u003eBurn Blend is our amazing weight loss support meal replacement protein shake. Burn Blend contains a combination of arguably the most effective weight loss ingredients available, helping you towards your body goals whilst satisfying your hunger. Not only a great weight loss support product, Burn Blend comes in several amazing flavours so will act as a treat without you having to feel guilty. Burn Blend mixes ultra smooth and can be added as an ingredient to make a variety of treats, drinks and smoothies.\u003c\/p\u003e\u003c\/div\u003e\n\n\u003c\/div\u003e\n\n\n\u003c\/div\u003e\n","published_at":"2017-02-17T14:00:00+00:00","created_at":"2017-02-17T14:58:59+00:00","vendor":"Grilla Fitness","type":"SUPPLEMENTS,Protein,Featured","tags":["Diet Protein","Fat Burners and Weight Loss","Grilla","Shop By Brand G - L","Shop By Category A - G","Weight Loss"],"price":3199,"price_min":3199,"price_max":3199,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":31087783241,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"GRILLABBLENDPC","requires_shipping":true,"taxable":false,"featured_image":null,"available":true,"name":"Burn Blend Diet Protein Shake Peanut Chocotini","public_title":null,"options":["Default Title"],"price":3199,"weight":1130,"compare_at_price":null,"inventory_quantity":111,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090208"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/chocotini.png?v=1564601626"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/chocotini.png?v=1564601626","options":["Title"],"content":"\u003c!-- Created with Shogun. --\u003e\n\n\u003cdiv class=\"shogun-root\" data-shogun-id=\"5d6929e22959d4004fa52248\" data-shogun-site-id=\"594a632b-8f27-4fa6-bc19-96f7d437e854\" data-shogun-page-id=\"5d6929e22959d4004fa52248\" data-shogun-page-version-id=\"5d972578bc3c8f005dc5322e\" data-shogun-platform-type=\"shopify\" data-shogun-variant-id=\"5d972578bc3c8f005dc53450\" data-region=\"main\"\u003e\n \n\n\u003cdiv id=\"s-932b5205-1234-469a-880b-7cae49ec0c71\" class=\"shg-c \"\u003e\n \u003cdiv class=\"shg-rich-text shg-theme-text-content\"\u003e\u003cp\u003eBurn Blend is our amazing weight loss support meal replacement protein shake. Burn Blend contains a combination of arguably the most effective weight loss ingredients available, helping you towards your body goals whilst satisfying your hunger. Not only a great weight loss support product, Burn Blend comes in several amazing flavours so will act as a treat without you having to feel guilty. Burn Blend mixes ultra smooth and can be added as an ingredient to make a variety of treats, drinks and smoothies.\u003c\/p\u003e\u003c\/div\u003e\n\n\u003c\/div\u003e\n\n\n\u003c\/div\u003e\n"}

Burn Blend Diet Protein Shake Peanut Chocotini

£31.99
Burn Blend is our amazing weight loss support meal replacement protein shake. Burn Blend contains a combination of arguably the most effective weight loss ingredients available, helping you towards your body goals whilst satisfying your hunger. Not only a great weight loss support product, Burn Blend comes in several amazing...
Sale 30% off
Levels Pre Workout Blue Raspberry
{"id":1407845761117,"title":"Levels Pre Workout Blue Raspberry","handle":"levels-pre-workout-blue-raspberry","description":"\u003c!-- Created with Shogun. --\u003e\n\n\u003cdiv class=\"shogun-root\" data-shogun-id=\"5d692f09f93b0e004daa14f3\" data-shogun-site-id=\"594a632b-8f27-4fa6-bc19-96f7d437e854\" data-shogun-page-id=\"5d692f09f93b0e004daa14f3\" data-shogun-page-version-id=\"5d6b8523db2c3a00526dab46\" data-shogun-platform-type=\"shopify\" data-shogun-variant-id=\"5d6b8524db2c3a00526dad66\" data-region=\"main\"\u003e\n \n\n\u003cdiv id=\"s-20f5bb8a-a198-4b57-aeca-2615cbb12432\" class=\"shg-c \"\u003e\n \u003cdiv class=\"shg-rich-text shg-theme-text-content\"\u003e\u003cp\u003eLevels is formulated to help you smash your training sessions and sporting activities. It is designed to give you energy and focus to push you where you want to be! It is simply the next Level in pre-workout supplementation No cutting corners, no micro-dosing no compromise.\u003c\/p\u003e\u003c\/div\u003e\n\n\u003c\/div\u003e\n\n\n\u003c\/div\u003e\n","published_at":"2018-09-10T16:56:58+01:00","created_at":"2018-09-08T14:31:29+01:00","vendor":"Grilla Fitness","type":"SUPPLEMENTS,Featured","tags":[],"price":1960,"price_min":1960,"price_max":1960,"available":true,"price_varies":false,"compare_at_price":2800,"compare_at_price_min":2800,"compare_at_price_max":2800,"compare_at_price_varies":false,"variants":[{"id":12474887929949,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"LevelsBR","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Levels Pre Workout Blue Raspberry","public_title":null,"options":["Default Title"],"price":1960,"weight":470,"compare_at_price":2800,"inventory_quantity":358,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090895"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/Raspberrylevels.png?v=1564601062"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/Raspberrylevels.png?v=1564601062","options":["Title"],"content":"\u003c!-- Created with Shogun. --\u003e\n\n\u003cdiv class=\"shogun-root\" data-shogun-id=\"5d692f09f93b0e004daa14f3\" data-shogun-site-id=\"594a632b-8f27-4fa6-bc19-96f7d437e854\" data-shogun-page-id=\"5d692f09f93b0e004daa14f3\" data-shogun-page-version-id=\"5d6b8523db2c3a00526dab46\" data-shogun-platform-type=\"shopify\" data-shogun-variant-id=\"5d6b8524db2c3a00526dad66\" data-region=\"main\"\u003e\n \n\n\u003cdiv id=\"s-20f5bb8a-a198-4b57-aeca-2615cbb12432\" class=\"shg-c \"\u003e\n \u003cdiv class=\"shg-rich-text shg-theme-text-content\"\u003e\u003cp\u003eLevels is formulated to help you smash your training sessions and sporting activities. It is designed to give you energy and focus to push you where you want to be! It is simply the next Level in pre-workout supplementation No cutting corners, no micro-dosing no compromise.\u003c\/p\u003e\u003c\/div\u003e\n\n\u003c\/div\u003e\n\n\n\u003c\/div\u003e\n"}

Levels Pre Workout Blue Raspberry
Blue Raspberry

£19.60 £28.00

Levels Pre Workout Blue Raspberry

£19.60 £28.00
Levels is formulated to help you smash your training sessions and sporting activities. It is designed to give you energy and focus to push you where you want to be! It is simply the next Level in pre-workout supplementation No cutting corners, no micro-dosing no compromise.
Sale 50% off
Grilla Black Out leggings Grilla Black Out leggings
{"id":8782661513,"title":"Grilla Black Out leggings","handle":"grilla-black-out-leggings","description":"\u003cp\u003eOur Black Out Leggings are high waisted and very flattering. These versatile Leggings are a must for your fitness wear collection as they can be worn with most outfits while still looking great. They include a handy rear zipped pocket and some eye catching pink detailing \u003cbr\u003e Key Notes\u003cbr\u003e Great fit\u003cbr\u003e High waisted\u003cbr\u003e Zip Pocket\u003cbr\u003e Body enhancing\u003cbr\u003e Great Design\u003cbr\u003e 92% Polyester 8% Elastane \u003cbr\u003e \u003cbr\u003e Model is 5,6 and wears small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e","published_at":"2017-01-31T14:44:41+00:00","created_at":"2017-01-31T14:44:44+00:00","vendor":"Grilla Clothing","type":"WOMENS","tags":[],"price":900,"price_min":900,"price_max":900,"available":true,"price_varies":false,"compare_at_price":1800,"compare_at_price_min":1800,"compare_at_price_max":1800,"compare_at_price_varies":false,"variants":[{"id":30067902025,"title":"S","option1":"S","option2":null,"option3":null,"sku":"BlackoutS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353386057,"product_id":8782661513,"position":1,"created_at":"2017-01-31T14:44:45+00:00","updated_at":"2017-01-31T14:44:45+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillablackoutleggingspinkfront.jpg?v=1485873885","variant_ids":[30067902025,30067902089,30067902153]},"available":true,"name":"Grilla Black Out leggings - S","public_title":"S","options":["S"],"price":900,"weight":4000,"compare_at_price":1800,"inventory_quantity":20,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090338"},{"id":30067902089,"title":"M","option1":"M","option2":null,"option3":null,"sku":"BlackoutM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353386057,"product_id":8782661513,"position":1,"created_at":"2017-01-31T14:44:45+00:00","updated_at":"2017-01-31T14:44:45+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillablackoutleggingspinkfront.jpg?v=1485873885","variant_ids":[30067902025,30067902089,30067902153]},"available":true,"name":"Grilla Black Out leggings - M","public_title":"M","options":["M"],"price":900,"weight":4000,"compare_at_price":1800,"inventory_quantity":9,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090345"},{"id":30067902153,"title":"L","option1":"L","option2":null,"option3":null,"sku":"BlackoutL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353386057,"product_id":8782661513,"position":1,"created_at":"2017-01-31T14:44:45+00:00","updated_at":"2017-01-31T14:44:45+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillablackoutleggingspinkfront.jpg?v=1485873885","variant_ids":[30067902025,30067902089,30067902153]},"available":true,"name":"Grilla Black Out leggings - L","public_title":"L","options":["L"],"price":900,"weight":4000,"compare_at_price":1800,"inventory_quantity":31,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090352"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillablackoutleggingspinkfront.jpg?v=1485873885","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillablackoutleggingspinkback.jpg?v=1485873885","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillablackoutleggingspinkbackdetail.jpg?v=1485873885","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillablackoutleggingspinkalternative.jpg?v=1485873885"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillablackoutleggingspinkfront.jpg?v=1485873885","options":["size"],"content":"\u003cp\u003eOur Black Out Leggings are high waisted and very flattering. These versatile Leggings are a must for your fitness wear collection as they can be worn with most outfits while still looking great. They include a handy rear zipped pocket and some eye catching pink detailing \u003cbr\u003e Key Notes\u003cbr\u003e Great fit\u003cbr\u003e High waisted\u003cbr\u003e Zip Pocket\u003cbr\u003e Body enhancing\u003cbr\u003e Great Design\u003cbr\u003e 92% Polyester 8% Elastane \u003cbr\u003e \u003cbr\u003e Model is 5,6 and wears small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e"}

Grilla Black Out leggings

£9.00 £18.00

Grilla Black Out leggings

£9.00 £18.00
Our Black Out Leggings are high waisted and very flattering. These versatile Leggings are a must for your fitness wear collection as they can be worn with most outfits while still looking great. They include a handy rear zipped pocket and some eye catching pink detailing Key Notes Great fit...
Sale 41% off
Burn Blend Diet Vegan Protein Shake
{"id":114885885961,"title":"Burn Blend Diet Vegan Protein Shake","handle":"burn-blend-diet-vegan-protein-shake","description":"\u003c!-- Created with Shogun. --\u003e\n\u003cdiv class=\"shogun-root\" data-shogun-id=\"5a44d38564f65b0037eff3d6\" data-shogun-site-id=\"594a632b-8f27-4fa6-bc19-96f7d437e854\" data-shogun-page-id=\"5a44d38564f65b0037eff3d6\" data-shogun-page-version-id=\"5a4ea1ae24110a004f2927bf\" data-region=\"main\"\u003e\n\u003cdiv id=\"s-05113461-d331-4ebe-a13b-70654a27a245\" class=\"shg-c \"\u003e\n\u003cp\u003eLow Calorie - Low fat - All Green!\u003c\/p\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e","published_at":"2018-01-04T15:44:39+00:00","created_at":"2017-12-15T11:15:14+00:00","vendor":"Grilla Fitness","type":"SUPPLEMENTS,Protein,Featured","tags":[],"price":1900,"price_min":1900,"price_max":1900,"available":true,"price_varies":false,"compare_at_price":3199,"compare_at_price_min":3199,"compare_at_price_max":3199,"compare_at_price_varies":false,"variants":[{"id":1484810354697,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"BBLENDVEGV","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Burn Blend Diet Vegan Protein Shake","public_title":null,"options":["Default Title"],"price":1900,"weight":1130,"compare_at_price":3199,"inventory_quantity":56,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090802"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/VeganVan.png?v=1557915757"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/VeganVan.png?v=1557915757","options":["Title"],"content":"\u003c!-- Created with Shogun. --\u003e\n\u003cdiv class=\"shogun-root\" data-shogun-id=\"5a44d38564f65b0037eff3d6\" data-shogun-site-id=\"594a632b-8f27-4fa6-bc19-96f7d437e854\" data-shogun-page-id=\"5a44d38564f65b0037eff3d6\" data-shogun-page-version-id=\"5a4ea1ae24110a004f2927bf\" data-region=\"main\"\u003e\n\u003cdiv id=\"s-05113461-d331-4ebe-a13b-70654a27a245\" class=\"shg-c \"\u003e\n\u003cp\u003eLow Calorie - Low fat - All Green!\u003c\/p\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e"}

Burn Blend Diet Vegan Protein Shake
Vanilla Essence

£19.00 £31.99

Burn Blend Diet Vegan Protein Shake

£19.00 £31.99
Low Calorie - Low fat - All Green!
Grilla Water Bottle Jug
{"id":17647861769,"title":"Grilla Water Bottle Jug","handle":"grilla-water-bottle-jug-blue","description":"\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003eStay hydrated with this blue gym drinking bottle. At 1.89 litres it's the most convenient way of carrying your water and why not add your supplements such as BCAA's or pre-workout.\u003c\/p\u003e\n\u003cp\u003eThese bottles are the most stylish way of staying hydrated all day while on the go or working those sets at the gym.\u003c\/p\u003e","published_at":"2017-09-26T00:16:43+01:00","created_at":"2017-10-02T16:32:52+01:00","vendor":"Grilla Fitness","type":"ACCESSORIES","tags":[],"price":899,"price_min":899,"price_max":899,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":135182811145,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"GrillaWtrJugBlu","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Grilla Water Bottle Jug","public_title":null,"options":["Default Title"],"price":899,"weight":160,"compare_at_price":null,"inventory_quantity":897,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090147"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/GrillaWaterJug-Blue.jpg?v=1506958388"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/GrillaWaterJug-Blue.jpg?v=1506958388","options":["Title"],"content":"\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003eStay hydrated with this blue gym drinking bottle. At 1.89 litres it's the most convenient way of carrying your water and why not add your supplements such as BCAA's or pre-workout.\u003c\/p\u003e\n\u003cp\u003eThese bottles are the most stylish way of staying hydrated all day while on the go or working those sets at the gym.\u003c\/p\u003e"}

Grilla Water Bottle Jug

£8.99
Stay hydrated with this blue gym drinking bottle. At 1.89 litres it's the most convenient way of carrying your water and why not add your supplements such as BCAA's or pre-workout. These bottles are the most stylish way of staying hydrated all day while on the go or working those sets at the gym.
Purify

Purify
Detox & Cleanse

£16.00

Purify

£16.00
To combat the excesses of life, its time to Purify! Purify capsules work by detoxifying the liver, skin and kidneys. Detoxifying the body is a key element in improving energy levels, raising metabolism, boosting the immune system and combating the feeling of fatigue and tiredness. Directions for Use Adults, take 2 capsules per...
Hey-Glo

Hey-Glo
Hair - Skin - Nails

£18.00

Hey-Glo

£18.00
Hey.....boost your inner Glo!   Hey-Glo is a complex of vitamins, minerals  and detoxifiers combined to unleash your inner glow! Vitamin C boosts energy levels and contributes to collagen formation which helps resist the onset of wrinkles. Zinc, Vitamin A and Biotin, aid in promoting a healthy skin glow, whilst nourishing hair and nails.  Directions for Use Adults, take 2...
Sale 40% off
Creatine Monohydrate - 500g ULTRA PURE
{"id":1582677557341,"title":"Creatine Monohydrate - 500g ULTRA PURE","handle":"creatine-monohydrate-500g-ultra-pure","description":"\u003cp\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eWho is it for?\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eOur Ultra Pure Creatine Monohydrate is perfect for those requiring an extra edge during any type of training or exercise. Creatine helps deliver the energy which powers our muscles. It is present naturally in meat and fish but in very small quantities, therefore supplementation with Creatine can be highly effective when trying to increase your training output.\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003eImprove energy levels\u003c\/li\u003e\n\u003cli\u003eIncrease strength\u003c\/li\u003e\n\u003cli\u003eHelps with explosive strength and power delivery\u003c\/li\u003e\n\u003cli\u003eReduce fatigue and recovery times\u003c\/li\u003e\n\u003cli\u003eTrain harder for longer\u003c\/li\u003e\n\u003cli\u003eVegan friendly\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003eOur Creatine Monohydrate is of the highest quality and ultra fine, meaning fast and effective absorption for maximum effect.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eInformation\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e100 x 5g Servings of Creatine Monohdyrate\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eDirections for use\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eMix 5g (1 serving) with water or a milk based drink. Prepare as a drink and take daily for 7 days. After 7 days take 1 drink every second day, or as your health professional advises. Do not exceed recommended daily intake.  \u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e","published_at":"2018-11-29T15:31:11+00:00","created_at":"2018-11-29T12:19:23+00:00","vendor":"Grilla Fitness","type":"SUPPLEMENTS","tags":[],"price":900,"price_min":900,"price_max":900,"available":true,"price_varies":false,"compare_at_price":1499,"compare_at_price_min":1499,"compare_at_price_max":1499,"compare_at_price_varies":false,"variants":[{"id":15458321137757,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"CREAT500","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Creatine Monohydrate - 500g ULTRA PURE","public_title":null,"options":["Default Title"],"price":900,"weight":580,"compare_at_price":1499,"inventory_quantity":405,"inventory_management":"shopify","inventory_policy":"deny","barcode":""}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/creatine.png?v=1564600334"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/creatine.png?v=1564600334","options":["Title"],"content":"\u003cp\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eWho is it for?\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eOur Ultra Pure Creatine Monohydrate is perfect for those requiring an extra edge during any type of training or exercise. Creatine helps deliver the energy which powers our muscles. It is present naturally in meat and fish but in very small quantities, therefore supplementation with Creatine can be highly effective when trying to increase your training output.\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003eImprove energy levels\u003c\/li\u003e\n\u003cli\u003eIncrease strength\u003c\/li\u003e\n\u003cli\u003eHelps with explosive strength and power delivery\u003c\/li\u003e\n\u003cli\u003eReduce fatigue and recovery times\u003c\/li\u003e\n\u003cli\u003eTrain harder for longer\u003c\/li\u003e\n\u003cli\u003eVegan friendly\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003eOur Creatine Monohydrate is of the highest quality and ultra fine, meaning fast and effective absorption for maximum effect.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eInformation\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e100 x 5g Servings of Creatine Monohdyrate\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eDirections for use\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eMix 5g (1 serving) with water or a milk based drink. Prepare as a drink and take daily for 7 days. After 7 days take 1 drink every second day, or as your health professional advises. Do not exceed recommended daily intake.  \u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e"}

Creatine Monohydrate - 500g ULTRA PURE

£9.00 £14.99
Who is it for? Our Ultra Pure Creatine Monohydrate is perfect for those requiring an extra edge during any type of training or exercise. Creatine helps deliver the energy which powers our muscles. It is present naturally in meat and fish but in very small quantities, therefore supplementation with Creatine can...
Sale 30% off
Levels Pre Workout Cola
{"id":1407836618845,"title":"Levels Pre Workout Cola","handle":"levels-pre-work-out-cola","description":"\u003c!-- Created with Shogun. --\u003e\n\n\u003cdiv class=\"shogun-root\" data-shogun-id=\"5d692f848bf54a004dec4d76\" data-shogun-site-id=\"594a632b-8f27-4fa6-bc19-96f7d437e854\" data-shogun-page-id=\"5d692f848bf54a004dec4d76\" data-shogun-page-version-id=\"5d6b85c9b1f2ea004c5eef36\" data-shogun-platform-type=\"shopify\" data-shogun-variant-id=\"5d6b85c9b1f2ea004c5ef156\" data-region=\"main\"\u003e\n \n\n\u003cdiv id=\"s-71003bc8-0f85-4f96-b304-42be2b19ad81\" class=\"shg-c \"\u003e\n \u003cdiv class=\"shg-rich-text shg-theme-text-content\"\u003e\u003cp\u003eLevels is formulated to help you smash your training sessions and sporting activities. It is designed to give you energy and focus to push you where you want to be! It is simply the next Level in pre-workout supplementation No cutting corners, no micro-dosing no compromise.\u003c\/p\u003e\u003c\/div\u003e\n\n\u003c\/div\u003e\n\n\n\u003c\/div\u003e\n","published_at":"2018-09-10T16:39:22+01:00","created_at":"2018-09-08T14:11:40+01:00","vendor":"Grilla Fitness","type":"SUPPLEMENTS,Featured","tags":[],"price":1960,"price_min":1960,"price_max":1960,"available":true,"price_varies":false,"compare_at_price":2800,"compare_at_price_min":2800,"compare_at_price_max":2800,"compare_at_price_varies":false,"variants":[{"id":12474859585629,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"LevelsCO","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Levels Pre Workout Cola","public_title":null,"options":["Default Title"],"price":1960,"weight":470,"compare_at_price":2800,"inventory_quantity":394,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090918"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/colalevels.png?v=1564600946"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/colalevels.png?v=1564600946","options":["Title"],"content":"\u003c!-- Created with Shogun. --\u003e\n\n\u003cdiv class=\"shogun-root\" data-shogun-id=\"5d692f848bf54a004dec4d76\" data-shogun-site-id=\"594a632b-8f27-4fa6-bc19-96f7d437e854\" data-shogun-page-id=\"5d692f848bf54a004dec4d76\" data-shogun-page-version-id=\"5d6b85c9b1f2ea004c5eef36\" data-shogun-platform-type=\"shopify\" data-shogun-variant-id=\"5d6b85c9b1f2ea004c5ef156\" data-region=\"main\"\u003e\n \n\n\u003cdiv id=\"s-71003bc8-0f85-4f96-b304-42be2b19ad81\" class=\"shg-c \"\u003e\n \u003cdiv class=\"shg-rich-text shg-theme-text-content\"\u003e\u003cp\u003eLevels is formulated to help you smash your training sessions and sporting activities. It is designed to give you energy and focus to push you where you want to be! It is simply the next Level in pre-workout supplementation No cutting corners, no micro-dosing no compromise.\u003c\/p\u003e\u003c\/div\u003e\n\n\u003c\/div\u003e\n\n\n\u003c\/div\u003e\n"}

Levels Pre Workout Cola
Cola

£19.60 £28.00

Levels Pre Workout Cola

£19.60 £28.00
Levels is formulated to help you smash your training sessions and sporting activities. It is designed to give you energy and focus to push you where you want to be! It is simply the next Level in pre-workout supplementation No cutting corners, no micro-dosing no compromise.
Sale 50% off
Grilla FreeStyle Breathable Vest Grilla FreeStyle Breathable Vest
{"id":8782655433,"title":"Grilla FreeStyle Breathable Vest","handle":"grilla-freestyle-breathable-vest-pink","description":"\u003cp\u003eThe Grilla FreeStyle breathable vest is part of our launch collection. The FreeStyle uses a high quality lightweight performance material which provides support yet figure flattering styling. It feels great to the touch, including breathable mesh panelling on the front and back which is arranged to the contours of the body. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Figure enhancing fit\u003cbr\u003e Light Weight yet high quality fabric\u003cbr\u003e Shell: 92% Polyester 8% Elastane \u003cbr\u003e Panel: 92% Polyester 8% Elastane\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eModel is 5,6 and wears small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e","published_at":"2017-01-31T14:43:00+00:00","created_at":"2017-01-31T14:44:01+00:00","vendor":"Grilla Clothing","type":"WOMENS","tags":[],"price":700,"price_min":700,"price_max":700,"available":true,"price_varies":false,"compare_at_price":1400,"compare_at_price_min":1400,"compare_at_price_max":1400,"compare_at_price_varies":false,"variants":[{"id":30067867209,"title":"S","option1":"S","option2":null,"option3":null,"sku":"FreeStylePS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353371977,"product_id":8782655433,"position":1,"created_at":"2017-01-31T14:44:02+00:00","updated_at":"2017-01-31T14:44:02+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkfront.jpg?v=1485873842","variant_ids":[30067867209,30067867273,30067867337]},"available":true,"name":"Grilla FreeStyle Breathable Vest - S","public_title":"S","options":["S"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":66,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090529"},{"id":30067867273,"title":"M","option1":"M","option2":null,"option3":null,"sku":"FreeStylePM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353371977,"product_id":8782655433,"position":1,"created_at":"2017-01-31T14:44:02+00:00","updated_at":"2017-01-31T14:44:02+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkfront.jpg?v=1485873842","variant_ids":[30067867209,30067867273,30067867337]},"available":true,"name":"Grilla FreeStyle Breathable Vest - M","public_title":"M","options":["M"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":64,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090536"},{"id":30067867337,"title":"L","option1":"L","option2":null,"option3":null,"sku":"FreeStylePL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353371977,"product_id":8782655433,"position":1,"created_at":"2017-01-31T14:44:02+00:00","updated_at":"2017-01-31T14:44:02+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkfront.jpg?v=1485873842","variant_ids":[30067867209,30067867273,30067867337]},"available":true,"name":"Grilla FreeStyle Breathable Vest - L","public_title":"L","options":["L"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":69,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090543"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkfront.jpg?v=1485873842","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkback.jpg?v=1485873842","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkside.jpg?v=1485873842"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkfront.jpg?v=1485873842","options":["size"],"content":"\u003cp\u003eThe Grilla FreeStyle breathable vest is part of our launch collection. The FreeStyle uses a high quality lightweight performance material which provides support yet figure flattering styling. It feels great to the touch, including breathable mesh panelling on the front and back which is arranged to the contours of the body. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Figure enhancing fit\u003cbr\u003e Light Weight yet high quality fabric\u003cbr\u003e Shell: 92% Polyester 8% Elastane \u003cbr\u003e Panel: 92% Polyester 8% Elastane\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eModel is 5,6 and wears small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e"}

Grilla FreeStyle Breathable Vest
Pink

£7.00 £14.00

Grilla FreeStyle Breathable Vest

£7.00 £14.00
The Grilla FreeStyle breathable vest is part of our launch collection. The FreeStyle uses a high quality lightweight performance material which provides support yet figure flattering styling. It feels great to the touch, including breathable mesh panelling on the front and back which is arranged to the contours of the...
Sale 50% off
Grilla Freeflow Breathable Crew Grilla Freeflow Breathable Crew
{"id":8782653449,"title":"Grilla Freeflow Breathable Crew","handle":"grilla-freeflow-breathable-crew-grey","description":"The Grilla Freeflow breathable Crew is part of our launch collection. The Freeflow uses a high quality performance material which provides compression yet allows freedom for explosive movement when called upon. It includes breathable mesh panelling on the back which is arranged to the contours of the back muscles to give a physique enhancing result. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e Compression feel\u003cbr\u003e \u003cbr\u003e Model is 5,11 and wears medium","published_at":"2017-01-31T14:43:00+00:00","created_at":"2017-01-31T14:43:38+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":1000,"price_min":1000,"price_max":1000,"available":true,"price_varies":false,"compare_at_price":2000,"compare_at_price_min":2000,"compare_at_price_max":2000,"compare_at_price_varies":false,"variants":[{"id":30067859529,"title":"S","option1":"S","option2":null,"option3":null,"sku":"FreeflowGS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353365961,"product_id":8782653449,"position":1,"created_at":"2017-01-31T14:43:38+00:00","updated_at":"2017-01-31T14:43:38+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewfront.jpg?v=1485873818","variant_ids":[30067859529,30067859593,30067859657,30067859721]},"available":true,"name":"Grilla Freeflow Breathable Crew - S","public_title":"S","options":["S"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":350,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090628"},{"id":30067859593,"title":"M","option1":"M","option2":null,"option3":null,"sku":"FreeflowGM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353365961,"product_id":8782653449,"position":1,"created_at":"2017-01-31T14:43:38+00:00","updated_at":"2017-01-31T14:43:38+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewfront.jpg?v=1485873818","variant_ids":[30067859529,30067859593,30067859657,30067859721]},"available":true,"name":"Grilla Freeflow Breathable Crew - M","public_title":"M","options":["M"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":372,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090635"},{"id":30067859657,"title":"L","option1":"L","option2":null,"option3":null,"sku":"FreeflowGL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353365961,"product_id":8782653449,"position":1,"created_at":"2017-01-31T14:43:38+00:00","updated_at":"2017-01-31T14:43:38+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewfront.jpg?v=1485873818","variant_ids":[30067859529,30067859593,30067859657,30067859721]},"available":true,"name":"Grilla Freeflow Breathable Crew - L","public_title":"L","options":["L"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":277,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090642"},{"id":30067859721,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"FreeflowGXL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353365961,"product_id":8782653449,"position":1,"created_at":"2017-01-31T14:43:38+00:00","updated_at":"2017-01-31T14:43:38+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewfront.jpg?v=1485873818","variant_ids":[30067859529,30067859593,30067859657,30067859721]},"available":true,"name":"Grilla Freeflow Breathable Crew - XL","public_title":"XL","options":["XL"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":142,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090659"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewfront.jpg?v=1485873818","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewback.jpg?v=1485873818"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewfront.jpg?v=1485873818","options":["size"],"content":"The Grilla Freeflow breathable Crew is part of our launch collection. The Freeflow uses a high quality performance material which provides compression yet allows freedom for explosive movement when called upon. It includes breathable mesh panelling on the back which is arranged to the contours of the back muscles to give a physique enhancing result. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e Compression feel\u003cbr\u003e \u003cbr\u003e Model is 5,11 and wears medium"}

Grilla Freeflow Breathable Crew
Grey

£10.00 £20.00

Grilla Freeflow Breathable Crew

£10.00 £20.00
The Grilla Freeflow breathable Crew is part of our launch collection. The Freeflow uses a high quality performance material which provides compression yet allows freedom for explosive movement when called upon. It includes breathable mesh panelling on the back which is arranged to the contours of the back muscles to...
Sale 50% off
Grilla Pyro Leggings Grilla Pyro Leggings
{"id":8782662601,"title":"Grilla Pyro Leggings","handle":"grilla-pyro-leggings","description":"\u003cp\u003eOur Pryo Leggings are high waisted and very flattering. Make a big statement when you train by wearing these! Our eye catching pyro Leggings are for the bold fitness girls and are certain to gain you many complimentary comments. These high quality, flexible leggings will support you in all the right places. \u003cbr\u003e Key Notes\u003cbr\u003e Great fit\u003cbr\u003e High waisted\u003cbr\u003e Zip Pocket\u003cbr\u003e Body enhancing\u003cbr\u003e Great Design\u003cbr\u003e 92% Polyester 8% Elastane \u003cbr\u003e \u003cbr\u003e Model is 5,6 and wears size small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e","published_at":"2017-01-31T14:44:00+00:00","created_at":"2017-01-31T14:44:54+00:00","vendor":"Grilla Clothing","type":"WOMENS","tags":["Womens Gym Training Apparel"],"price":1000,"price_min":1000,"price_max":1000,"available":true,"price_varies":false,"compare_at_price":2000,"compare_at_price_min":2000,"compare_at_price_max":2000,"compare_at_price_varies":false,"variants":[{"id":30067915593,"title":"S","option1":"S","option2":null,"option3":null,"sku":"PyroS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353390665,"product_id":8782662601,"position":1,"created_at":"2017-01-31T14:44:54+00:00","updated_at":"2017-01-31T14:44:54+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfront.jpg?v=1485873894","variant_ids":[30067915593,30067915657,30067915721]},"available":true,"name":"Grilla Pyro Leggings - S","public_title":"S","options":["S"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":37,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090307"},{"id":30067915657,"title":"M","option1":"M","option2":null,"option3":null,"sku":"PyroM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353390665,"product_id":8782662601,"position":1,"created_at":"2017-01-31T14:44:54+00:00","updated_at":"2017-01-31T14:44:54+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfront.jpg?v=1485873894","variant_ids":[30067915593,30067915657,30067915721]},"available":true,"name":"Grilla Pyro Leggings - M","public_title":"M","options":["M"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":35,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090314"},{"id":30067915721,"title":"L","option1":"L","option2":null,"option3":null,"sku":"PyroL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353390665,"product_id":8782662601,"position":1,"created_at":"2017-01-31T14:44:54+00:00","updated_at":"2017-01-31T14:44:54+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfront.jpg?v=1485873894","variant_ids":[30067915593,30067915657,30067915721]},"available":true,"name":"Grilla Pyro Leggings - L","public_title":"L","options":["L"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":52,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090321"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfront.jpg?v=1485873894","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkback.jpg?v=1485873894","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfulllength.jpg?v=1485873894","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfulllengthback.jpg?v=1485873894"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfront.jpg?v=1485873894","options":["size"],"content":"\u003cp\u003eOur Pryo Leggings are high waisted and very flattering. Make a big statement when you train by wearing these! Our eye catching pyro Leggings are for the bold fitness girls and are certain to gain you many complimentary comments. These high quality, flexible leggings will support you in all the right places. \u003cbr\u003e Key Notes\u003cbr\u003e Great fit\u003cbr\u003e High waisted\u003cbr\u003e Zip Pocket\u003cbr\u003e Body enhancing\u003cbr\u003e Great Design\u003cbr\u003e 92% Polyester 8% Elastane \u003cbr\u003e \u003cbr\u003e Model is 5,6 and wears size small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e"}

Grilla Pyro Leggings

£10.00 £20.00

Grilla Pyro Leggings

£10.00 £20.00
Our Pryo Leggings are high waisted and very flattering. Make a big statement when you train by wearing these! Our eye catching pyro Leggings are for the bold fitness girls and are certain to gain you many complimentary comments. These high quality, flexible leggings will support you in all the...
Sale 30% off
Whey Isoblend
{"id":1581160398941,"title":"Whey Isoblend","handle":"whey-isoblend-chocolate-chunk","description":"\u003c!-- Created with Shogun. --\u003e\n\n\u003cdiv class=\"shogun-root\" data-shogun-id=\"5d6cdd8cf404d50052d16fc1\" data-shogun-site-id=\"594a632b-8f27-4fa6-bc19-96f7d437e854\" data-shogun-page-id=\"5d6cdd8cf404d50052d16fc1\" data-shogun-page-version-id=\"5d6cdd8cf404d50052d16fc0\" data-shogun-platform-type=\"shopify\" data-shogun-variant-id=\"5d6cdd8cf404d50052d16fc4\" data-region=\"main\"\u003e\n \n\n\u003cdiv id=\"s-b1e205c0-2ce6-4fca-b4e3-4d0860894e43\" class=\"shg-c \"\u003e\n \u003cp\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eWho is Isoblend for?\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eIsoblend is for those looking to tone, sculpt and build lean muscle mass. When training, Protein intake is essential to muscle growth and recovery. It can however, be very hard to obtain the correct amount of protein purely through food, which is why supplementing your diet with Isoblend can greatly improve muscle growth and recovery.  It is suitable for both men and women aiming to support their gym, sport or exercise activities\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003eAround 82% protein\u003c\/li\u003e\n\u003cli\u003eUltra high quality whey isolate content\u003c\/li\u003e\n\u003cli\u003eUltra Low calories, 116 per serving\u003c\/li\u003e\n\u003cli\u003eOnly 1.6g of carbs per serving\u003c\/li\u003e\n\u003cli\u003eWhey protein sourced from grass fed cows\u003c\/li\u003e\n\u003cli\u003eNon GMO\u003c\/li\u003e\n\u003cli\u003eNo added Gluten\u003c\/li\u003e\n\u003cli\u003eVegetarian Friendly\u003c\/li\u003e\n\u003cli\u003eAdded digestive enzymes to help break down nutrients\u003c\/li\u003e\n\u003cli\u003eIncredible taste!\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eNutrition\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003e                                   \u003cspan style=\"text-decoration: underline;\"\u003e\u003cspan\u003e Per 100g    Per 30g Portion   %RI* \u003c\/span\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cdiv\u003eEnergy (kj\/kcal)            1618\/387    485\/116                6% \u003c\/div\u003e\n\u003cdiv\u003eFat (g)                           4.3             1.3                        2% \u003c\/div\u003e\n\u003cdiv\u003eof which saturates (g)   2.7             0.8                        4% \u003c\/div\u003e\n\u003cdiv\u003eCarbohydrate (g)          5.4             1.6                        1% \u003c\/div\u003e\n\u003cdiv\u003eof which sugar (g)         3.5             1.0                        1% \u003c\/div\u003e\n\u003cdiv\u003eFibre (g)                        0.9             0.3 \u003c\/div\u003e\n\u003cdiv\u003eProtein (g)                    81.7            24.5                       49%\u003c\/div\u003e\n\u003cdiv\u003eSalt (g)                         0.4              0.1                         2%\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cdiv\u003e\n\u003cdiv\u003e\n\u003cspan style=\"text-decoration: underline;\"\u003eAmino Acid\u003c\/span\u003e                 \u003cspan style=\"text-decoration: underline;\"\u003ePer 100g      Per 30g\u003c\/span\u003e\n\u003c\/div\u003e\n\u003cdiv\u003eLeucine (g)                    7.0               2.1\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv\u003eIsoleucine (g)                 3.8               1.1\u003c\/div\u003e\n\u003cdiv\u003eValine (g)                       3.8               1.1\u003c\/div\u003e\n\u003cdiv\u003eAspartic Acid (g)            7.2               2.1\u003c\/div\u003e\n\u003cdiv\u003eGlutamic Acid (g)          11.5              3.4\u003c\/div\u003e\n\u003cdiv\u003eSerine (g)                       3.6              1.1\u003c\/div\u003e\n\u003cdiv\u003eGlycine (g)                     8.1               2.4\u003c\/div\u003e\n\u003cdiv\u003eHistidine (g)                   1.2               0.4\u003c\/div\u003e\n\u003cdiv\u003eArginine (g)                    1.8               0.5\u003c\/div\u003e\n\u003cdiv\u003eThreonine (g)                 4.9               1.5\u003c\/div\u003e\n\u003cdiv\u003eAlanine (g)                     5.9               1.8\u003c\/div\u003e\n\u003cdiv\u003eProline (g)                      3.8               1.1\u003c\/div\u003e\n\u003cdiv\u003eTyrosine (g)                    2.0               0.6\u003c\/div\u003e\n\u003cdiv\u003eMethionine (g)                1.2               0.4\u003c\/div\u003e\n\u003cdiv\u003eCystine (g)                     1.6               0.5\u003c\/div\u003e\n\u003cdiv\u003ePhenylalanine (g)           2.2              0.6\u003c\/div\u003e\n\u003cdiv\u003eLysine (g)                       11.3             3.4\u003c\/div\u003e\n\u003cdiv\u003eTryptophan (g)                0.9              0.3\u003c\/div\u003e\n\u003cdiv\u003eTotal                                81.7            25\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003c\/span\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003c\/span\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eIngredients\u003c\/span\u003e\u003c\/strong\u003e\u003cbr\u003eWhey Protein Concentrate (Contains Emulsifier: Soya Lecithin) (Milk), Whey Protein Isolate (Milk), Whey Protein Hydrolysate (Milk), Flavouring, Thickener(Cellulose Gum), Digezyme Enzyme Complex (Alpha-Amylase, Neutral Protease, Lactase, Lipase, Cellulase), Sweeteners (Acesulfame Potassium, Sucralose).\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003ePreparation Instructions\u003c\/strong\u003e\u003c\/span\u003e\u003cbr\u003eAdd one scoop to 200ml of cold water in a shaker, fully skimmed milk, nut milk such as almond milk\/coconut milk. Shake well.\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003ch2\u003e\u003c\/h2\u003e\n\n\u003c\/div\u003e\n\n\n\u003c\/div\u003e\n","published_at":"2018-12-05T16:08:17+00:00","created_at":"2018-11-27T16:03:00+00:00","vendor":"Grilla Fitness","type":"SUPPLEMENTS","tags":[],"price":1820,"price_min":1820,"price_max":1820,"available":true,"price_varies":false,"compare_at_price":2600,"compare_at_price_min":2600,"compare_at_price_max":2600,"compare_at_price_varies":false,"variants":[{"id":15452142010461,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ISOBLCC","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Whey Isoblend","public_title":null,"options":["Default Title"],"price":1820,"weight":1130,"compare_at_price":2600,"inventory_quantity":258,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090864"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/chocolatechunk.png?v=1564602159"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/chocolatechunk.png?v=1564602159","options":["Title"],"content":"\u003c!-- Created with Shogun. --\u003e\n\n\u003cdiv class=\"shogun-root\" data-shogun-id=\"5d6cdd8cf404d50052d16fc1\" data-shogun-site-id=\"594a632b-8f27-4fa6-bc19-96f7d437e854\" data-shogun-page-id=\"5d6cdd8cf404d50052d16fc1\" data-shogun-page-version-id=\"5d6cdd8cf404d50052d16fc0\" data-shogun-platform-type=\"shopify\" data-shogun-variant-id=\"5d6cdd8cf404d50052d16fc4\" data-region=\"main\"\u003e\n \n\n\u003cdiv id=\"s-b1e205c0-2ce6-4fca-b4e3-4d0860894e43\" class=\"shg-c \"\u003e\n \u003cp\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eWho is Isoblend for?\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eIsoblend is for those looking to tone, sculpt and build lean muscle mass. When training, Protein intake is essential to muscle growth and recovery. It can however, be very hard to obtain the correct amount of protein purely through food, which is why supplementing your diet with Isoblend can greatly improve muscle growth and recovery.  It is suitable for both men and women aiming to support their gym, sport or exercise activities\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003eAround 82% protein\u003c\/li\u003e\n\u003cli\u003eUltra high quality whey isolate content\u003c\/li\u003e\n\u003cli\u003eUltra Low calories, 116 per serving\u003c\/li\u003e\n\u003cli\u003eOnly 1.6g of carbs per serving\u003c\/li\u003e\n\u003cli\u003eWhey protein sourced from grass fed cows\u003c\/li\u003e\n\u003cli\u003eNon GMO\u003c\/li\u003e\n\u003cli\u003eNo added Gluten\u003c\/li\u003e\n\u003cli\u003eVegetarian Friendly\u003c\/li\u003e\n\u003cli\u003eAdded digestive enzymes to help break down nutrients\u003c\/li\u003e\n\u003cli\u003eIncredible taste!\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eNutrition\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003e                                   \u003cspan style=\"text-decoration: underline;\"\u003e\u003cspan\u003e Per 100g    Per 30g Portion   %RI* \u003c\/span\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cdiv\u003eEnergy (kj\/kcal)            1618\/387    485\/116                6% \u003c\/div\u003e\n\u003cdiv\u003eFat (g)                           4.3             1.3                        2% \u003c\/div\u003e\n\u003cdiv\u003eof which saturates (g)   2.7             0.8                        4% \u003c\/div\u003e\n\u003cdiv\u003eCarbohydrate (g)          5.4             1.6                        1% \u003c\/div\u003e\n\u003cdiv\u003eof which sugar (g)         3.5             1.0                        1% \u003c\/div\u003e\n\u003cdiv\u003eFibre (g)                        0.9             0.3 \u003c\/div\u003e\n\u003cdiv\u003eProtein (g)                    81.7            24.5                       49%\u003c\/div\u003e\n\u003cdiv\u003eSalt (g)                         0.4              0.1                         2%\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cdiv\u003e\n\u003cdiv\u003e\n\u003cspan style=\"text-decoration: underline;\"\u003eAmino Acid\u003c\/span\u003e                 \u003cspan style=\"text-decoration: underline;\"\u003ePer 100g      Per 30g\u003c\/span\u003e\n\u003c\/div\u003e\n\u003cdiv\u003eLeucine (g)                    7.0               2.1\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv\u003eIsoleucine (g)                 3.8               1.1\u003c\/div\u003e\n\u003cdiv\u003eValine (g)                       3.8               1.1\u003c\/div\u003e\n\u003cdiv\u003eAspartic Acid (g)            7.2               2.1\u003c\/div\u003e\n\u003cdiv\u003eGlutamic Acid (g)          11.5              3.4\u003c\/div\u003e\n\u003cdiv\u003eSerine (g)                       3.6              1.1\u003c\/div\u003e\n\u003cdiv\u003eGlycine (g)                     8.1               2.4\u003c\/div\u003e\n\u003cdiv\u003eHistidine (g)                   1.2               0.4\u003c\/div\u003e\n\u003cdiv\u003eArginine (g)                    1.8               0.5\u003c\/div\u003e\n\u003cdiv\u003eThreonine (g)                 4.9               1.5\u003c\/div\u003e\n\u003cdiv\u003eAlanine (g)                     5.9               1.8\u003c\/div\u003e\n\u003cdiv\u003eProline (g)                      3.8               1.1\u003c\/div\u003e\n\u003cdiv\u003eTyrosine (g)                    2.0               0.6\u003c\/div\u003e\n\u003cdiv\u003eMethionine (g)                1.2               0.4\u003c\/div\u003e\n\u003cdiv\u003eCystine (g)                     1.6               0.5\u003c\/div\u003e\n\u003cdiv\u003ePhenylalanine (g)           2.2              0.6\u003c\/div\u003e\n\u003cdiv\u003eLysine (g)                       11.3             3.4\u003c\/div\u003e\n\u003cdiv\u003eTryptophan (g)                0.9              0.3\u003c\/div\u003e\n\u003cdiv\u003eTotal                                81.7            25\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003c\/span\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003c\/span\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eIngredients\u003c\/span\u003e\u003c\/strong\u003e\u003cbr\u003eWhey Protein Concentrate (Contains Emulsifier: Soya Lecithin) (Milk), Whey Protein Isolate (Milk), Whey Protein Hydrolysate (Milk), Flavouring, Thickener(Cellulose Gum), Digezyme Enzyme Complex (Alpha-Amylase, Neutral Protease, Lactase, Lipase, Cellulase), Sweeteners (Acesulfame Potassium, Sucralose).\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003ePreparation Instructions\u003c\/strong\u003e\u003c\/span\u003e\u003cbr\u003eAdd one scoop to 200ml of cold water in a shaker, fully skimmed milk, nut milk such as almond milk\/coconut milk. Shake well.\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003ch2\u003e\u003c\/h2\u003e\n\n\u003c\/div\u003e\n\n\n\u003c\/div\u003e\n"}

Whey Isoblend
Chocolate Chunk

£18.20 £26.00

Whey Isoblend

£18.20 £26.00
Who is Isoblend for? Isoblend is for those looking to tone, sculpt and build lean muscle mass. When training, Protein intake is essential to muscle growth and recovery. It can however, be very hard to obtain the correct amount of protein purely through food, which is why supplementing your diet...
Sale 30% off
Levels Pre Workout Green Apple
{"id":1407848054877,"title":"Levels Pre Workout Green Apple","handle":"levels-pre-workout-green-apple","description":"\u003c!-- Created with Shogun. --\u003e\n\n\u003cdiv class=\"shogun-root\" data-shogun-id=\"5d6930a5f13c37004cdfd100\" data-shogun-site-id=\"594a632b-8f27-4fa6-bc19-96f7d437e854\" data-shogun-page-id=\"5d6930a5f13c37004cdfd100\" data-shogun-page-version-id=\"5d6b86042427eb0052cf80af\" data-shogun-platform-type=\"shopify\" data-shogun-variant-id=\"5d6b86042427eb0052cf82cf\" data-region=\"main\"\u003e\n \n\n\u003cdiv id=\"s-08dbb8d3-2fd1-4c56-89b0-0766e4bd2b22\" class=\"shg-c \"\u003e\n \u003cdiv class=\"shg-rich-text shg-theme-text-content\"\u003e\u003cp\u003eLevels is formulated to help you smash your training sessions and sporting activities. It is designed to give you energy and focus to push you where you want to be! It is simply the next Level in pre-workout supplementation No cutting corners, no micro-dosing no compromise.\u003c\/p\u003e\u003c\/div\u003e\n\n\u003c\/div\u003e\n\n\n\u003c\/div\u003e\n","published_at":"2018-09-10T16:58:44+01:00","created_at":"2018-09-08T14:37:19+01:00","vendor":"Grilla Fitness","type":"SUPPLEMENTS,Featured","tags":[],"price":1960,"price_min":1960,"price_max":1960,"available":true,"price_varies":false,"compare_at_price":2800,"compare_at_price_min":2800,"compare_at_price_max":2800,"compare_at_price_varies":false,"variants":[{"id":12474895269981,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"LevelsGA","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Levels Pre Workout Green Apple","public_title":null,"options":["Default Title"],"price":1960,"weight":470,"compare_at_price":2800,"inventory_quantity":418,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090901"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/applelevels.png?v=1564601158"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/applelevels.png?v=1564601158","options":["Title"],"content":"\u003c!-- Created with Shogun. --\u003e\n\n\u003cdiv class=\"shogun-root\" data-shogun-id=\"5d6930a5f13c37004cdfd100\" data-shogun-site-id=\"594a632b-8f27-4fa6-bc19-96f7d437e854\" data-shogun-page-id=\"5d6930a5f13c37004cdfd100\" data-shogun-page-version-id=\"5d6b86042427eb0052cf80af\" data-shogun-platform-type=\"shopify\" data-shogun-variant-id=\"5d6b86042427eb0052cf82cf\" data-region=\"main\"\u003e\n \n\n\u003cdiv id=\"s-08dbb8d3-2fd1-4c56-89b0-0766e4bd2b22\" class=\"shg-c \"\u003e\n \u003cdiv class=\"shg-rich-text shg-theme-text-content\"\u003e\u003cp\u003eLevels is formulated to help you smash your training sessions and sporting activities. It is designed to give you energy and focus to push you where you want to be! It is simply the next Level in pre-workout supplementation No cutting corners, no micro-dosing no compromise.\u003c\/p\u003e\u003c\/div\u003e\n\n\u003c\/div\u003e\n\n\n\u003c\/div\u003e\n"}

Levels Pre Workout Green Apple
Green Apple

£19.60 £28.00

Levels Pre Workout Green Apple

£19.60 £28.00
Levels is formulated to help you smash your training sessions and sporting activities. It is designed to give you energy and focus to push you where you want to be! It is simply the next Level in pre-workout supplementation No cutting corners, no micro-dosing no compromise.
Sale 30% off
Levels Pre Workout Orange and Passion Fruit
{"id":1407844253789,"title":"Levels Pre Workout Orange and Passion Fruit","handle":"levels-pre-workout-orange-passion-fruit","description":"\u003c!-- Created with Shogun. --\u003e\n\n\u003cdiv class=\"shogun-root\" data-shogun-id=\"5d6930eff93b0e0059aaa0d0\" data-shogun-site-id=\"594a632b-8f27-4fa6-bc19-96f7d437e854\" data-shogun-page-id=\"5d6930eff93b0e0059aaa0d0\" data-shogun-page-version-id=\"5d6b86492427eb004ccf5e31\" data-shogun-platform-type=\"shopify\" data-shogun-variant-id=\"5d6b86492427eb004ccf6051\" data-region=\"main\"\u003e\n \n\n\u003cdiv id=\"s-76e20515-c7c9-4e64-83bb-026ceff48e08\" class=\"shg-c \"\u003e\n \u003cdiv class=\"shg-rich-text shg-theme-text-content\"\u003e\u003cp\u003eLevels is formulated to help you smash your training sessions and sporting activities. It is designed to give you energy and focus to push you where you want to be! It is simply the next Level in pre-workout supplementation No cutting corners, no micro-dosing no compromise.\u003c\/p\u003e\u003c\/div\u003e\n\n\u003c\/div\u003e\n\n\n\u003c\/div\u003e\n","published_at":"2018-09-10T16:59:29+01:00","created_at":"2018-09-08T14:27:26+01:00","vendor":"Grilla Fitness","type":"SUPPLEMENTS,Featured","tags":[],"price":1960,"price_min":1960,"price_max":1960,"available":true,"price_varies":false,"compare_at_price":2800,"compare_at_price_min":2800,"compare_at_price_max":2800,"compare_at_price_varies":false,"variants":[{"id":12474881081437,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"LevelsOR","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Levels Pre Workout Orange and Passion Fruit","public_title":null,"options":["Default Title"],"price":1960,"weight":470,"compare_at_price":2800,"inventory_quantity":431,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090925"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/OrangeLevels.png?v=1564601010"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/OrangeLevels.png?v=1564601010","options":["Title"],"content":"\u003c!-- Created with Shogun. --\u003e\n\n\u003cdiv class=\"shogun-root\" data-shogun-id=\"5d6930eff93b0e0059aaa0d0\" data-shogun-site-id=\"594a632b-8f27-4fa6-bc19-96f7d437e854\" data-shogun-page-id=\"5d6930eff93b0e0059aaa0d0\" data-shogun-page-version-id=\"5d6b86492427eb004ccf5e31\" data-shogun-platform-type=\"shopify\" data-shogun-variant-id=\"5d6b86492427eb004ccf6051\" data-region=\"main\"\u003e\n \n\n\u003cdiv id=\"s-76e20515-c7c9-4e64-83bb-026ceff48e08\" class=\"shg-c \"\u003e\n \u003cdiv class=\"shg-rich-text shg-theme-text-content\"\u003e\u003cp\u003eLevels is formulated to help you smash your training sessions and sporting activities. It is designed to give you energy and focus to push you where you want to be! It is simply the next Level in pre-workout supplementation No cutting corners, no micro-dosing no compromise.\u003c\/p\u003e\u003c\/div\u003e\n\n\u003c\/div\u003e\n\n\n\u003c\/div\u003e\n"}

Levels Pre Workout Orange and Passion Fruit
Orange & Passion Fruit

£19.60 £28.00

Levels Pre Workout Orange and Passion Fruit

£19.60 £28.00
Levels is formulated to help you smash your training sessions and sporting activities. It is designed to give you energy and focus to push you where you want to be! It is simply the next Level in pre-workout supplementation No cutting corners, no micro-dosing no compromise.
Sale 30% off
Whey Isoblend
{"id":1582755709021,"title":"Whey Isoblend","handle":"whey-isoblend-vanilla-ice-cream","description":"\u003cp\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eWho is Isoblend for?\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eIsoblend is for those looking to tone, sculpt and build lean muscle mass. When training, Protein intake is essential to muscle growth and recovery. It can however, be very hard to obtain the correct amount of protein purely through food, which is why supplementing your diet with Isoblend can greatly improve muscle growth and recovery.  It is suitable for both men and women aiming to support their gym, sport or exercise activities\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003eAround 82% protein\u003c\/li\u003e\n\u003cli\u003eUltra high quality whey isolate content\u003c\/li\u003e\n\u003cli\u003eUltra Low calories, 116 per serving\u003c\/li\u003e\n\u003cli\u003eOnly 1.6g of carbs per serving\u003c\/li\u003e\n\u003cli\u003eWhey protein sourced from grass fed cows\u003c\/li\u003e\n\u003cli\u003eNon GMO\u003c\/li\u003e\n\u003cli\u003eNo added Gluten\u003c\/li\u003e\n\u003cli\u003eVegetarian Friendly\u003c\/li\u003e\n\u003cli\u003eAdded digestive enzymes to help break down nutrients\u003c\/li\u003e\n\u003cli\u003eIncredible taste!\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eNutrition\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003e                                   \u003cspan style=\"text-decoration: underline;\"\u003e\u003cspan\u003e Per 100g    Per 30g Portion   %RI* \u003c\/span\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cdiv\u003eEnergy (kj\/kcal)            1618\/387    485\/116                6% \u003c\/div\u003e\n\u003cdiv\u003eFat (g)                           4.3             1.3                        2% \u003c\/div\u003e\n\u003cdiv\u003eof which saturates (g)   2.7             0.8                        4% \u003c\/div\u003e\n\u003cdiv\u003eCarbohydrate (g)          5.4             1.6                        1% \u003c\/div\u003e\n\u003cdiv\u003eof which sugar (g)         3.5             1.0                        1% \u003c\/div\u003e\n\u003cdiv\u003eFibre (g)                        0.9             0.3 \u003c\/div\u003e\n\u003cdiv\u003eProtein (g)                    81.7            24.5                       49%\u003c\/div\u003e\n\u003cdiv\u003eSalt (g)                         0.4              0.1                         2%\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cdiv\u003e\n\u003cdiv\u003e\n\u003cspan style=\"text-decoration: underline;\"\u003eAmino Acid\u003c\/span\u003e                 \u003cspan style=\"text-decoration: underline;\"\u003ePer 100g      Per 30g\u003c\/span\u003e\n\u003c\/div\u003e\n\u003cdiv\u003eLeucine (g)                    7.0               2.1\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv\u003eIsoleucine (g)                 3.8               1.1\u003c\/div\u003e\n\u003cdiv\u003eValine (g)                       3.8               1.1\u003c\/div\u003e\n\u003cdiv\u003eAspartic Acid (g)            7.2               2.1\u003c\/div\u003e\n\u003cdiv\u003eGlutamic Acid (g)          11.5              3.4\u003c\/div\u003e\n\u003cdiv\u003eSerine (g)                       3.6              1.1\u003c\/div\u003e\n\u003cdiv\u003eGlycine (g)                     8.1               2.4\u003c\/div\u003e\n\u003cdiv\u003eHistidine (g)                   1.2               0.4\u003c\/div\u003e\n\u003cdiv\u003eArginine (g)                    1.8               0.5\u003c\/div\u003e\n\u003cdiv\u003eThreonine (g)                 4.9               1.5\u003c\/div\u003e\n\u003cdiv\u003eAlanine (g)                     5.9               1.8\u003c\/div\u003e\n\u003cdiv\u003eProline (g)                      3.8               1.1\u003c\/div\u003e\n\u003cdiv\u003eTyrosine (g)                    2.0               0.6\u003c\/div\u003e\n\u003cdiv\u003eMethionine (g)                1.2               0.4\u003c\/div\u003e\n\u003cdiv\u003eCystine (g)                     1.6               0.5\u003c\/div\u003e\n\u003cdiv\u003ePhenylalanine (g)           2.2              0.6\u003c\/div\u003e\n\u003cdiv\u003eLysine (g)                       11.3             3.4\u003c\/div\u003e\n\u003cdiv\u003eTryptophan (g)                0.9              0.3\u003c\/div\u003e\n\u003cdiv\u003eTotal                                81.7            25\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003c\/span\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003c\/span\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003c\/span\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eIngredients\u003c\/span\u003e\u003c\/strong\u003e\u003cbr\u003eWhey Protein Concentrate (Contains Emulsifier: Soya Lecithin) (Milk), Whey Protein Isolate (Milk), Whey Protein Hydrolysate (Milk), Flavouring, Thickener(Cellulose Gum), Digezyme Enzyme Complex (Alpha-Amylase, Neutral Protease, Lactase, Lipase, Cellulase), Sweeteners (Acesulfame Potassium, Sucralose).\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003ePreparation Instructions\u003c\/strong\u003e\u003c\/span\u003e\u003cbr\u003eAdd one scoop to 200ml of cold water in a shaker, fully skimmed milk, nut milk such as almond milk\/coconut milk. Shake well.\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003ch2\u003e\u003c\/h2\u003e","published_at":"2018-12-05T16:09:36+00:00","created_at":"2018-11-29T14:39:09+00:00","vendor":"Grilla Fitness","type":"","tags":[],"price":1820,"price_min":1820,"price_max":1820,"available":true,"price_varies":false,"compare_at_price":2600,"compare_at_price_min":2600,"compare_at_price_max":2600,"compare_at_price_varies":false,"variants":[{"id":15458460565597,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ISOBLVIC","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Whey Isoblend","public_title":null,"options":["Default Title"],"price":1820,"weight":1130,"compare_at_price":2600,"inventory_quantity":281,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090888"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/vanilawhey.png?v=1564602256"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/vanilawhey.png?v=1564602256","options":["Title"],"content":"\u003cp\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eWho is Isoblend for?\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eIsoblend is for those looking to tone, sculpt and build lean muscle mass. When training, Protein intake is essential to muscle growth and recovery. It can however, be very hard to obtain the correct amount of protein purely through food, which is why supplementing your diet with Isoblend can greatly improve muscle growth and recovery.  It is suitable for both men and women aiming to support their gym, sport or exercise activities\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003eAround 82% protein\u003c\/li\u003e\n\u003cli\u003eUltra high quality whey isolate content\u003c\/li\u003e\n\u003cli\u003eUltra Low calories, 116 per serving\u003c\/li\u003e\n\u003cli\u003eOnly 1.6g of carbs per serving\u003c\/li\u003e\n\u003cli\u003eWhey protein sourced from grass fed cows\u003c\/li\u003e\n\u003cli\u003eNon GMO\u003c\/li\u003e\n\u003cli\u003eNo added Gluten\u003c\/li\u003e\n\u003cli\u003eVegetarian Friendly\u003c\/li\u003e\n\u003cli\u003eAdded digestive enzymes to help break down nutrients\u003c\/li\u003e\n\u003cli\u003eIncredible taste!\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eNutrition\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003e                                   \u003cspan style=\"text-decoration: underline;\"\u003e\u003cspan\u003e Per 100g    Per 30g Portion   %RI* \u003c\/span\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cdiv\u003eEnergy (kj\/kcal)            1618\/387    485\/116                6% \u003c\/div\u003e\n\u003cdiv\u003eFat (g)                           4.3             1.3                        2% \u003c\/div\u003e\n\u003cdiv\u003eof which saturates (g)   2.7             0.8                        4% \u003c\/div\u003e\n\u003cdiv\u003eCarbohydrate (g)          5.4             1.6                        1% \u003c\/div\u003e\n\u003cdiv\u003eof which sugar (g)         3.5             1.0                        1% \u003c\/div\u003e\n\u003cdiv\u003eFibre (g)                        0.9             0.3 \u003c\/div\u003e\n\u003cdiv\u003eProtein (g)                    81.7            24.5                       49%\u003c\/div\u003e\n\u003cdiv\u003eSalt (g)                         0.4              0.1                         2%\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cdiv\u003e\n\u003cdiv\u003e\n\u003cspan style=\"text-decoration: underline;\"\u003eAmino Acid\u003c\/span\u003e                 \u003cspan style=\"text-decoration: underline;\"\u003ePer 100g      Per 30g\u003c\/span\u003e\n\u003c\/div\u003e\n\u003cdiv\u003eLeucine (g)                    7.0               2.1\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv\u003eIsoleucine (g)                 3.8               1.1\u003c\/div\u003e\n\u003cdiv\u003eValine (g)                       3.8               1.1\u003c\/div\u003e\n\u003cdiv\u003eAspartic Acid (g)            7.2               2.1\u003c\/div\u003e\n\u003cdiv\u003eGlutamic Acid (g)          11.5              3.4\u003c\/div\u003e\n\u003cdiv\u003eSerine (g)                       3.6              1.1\u003c\/div\u003e\n\u003cdiv\u003eGlycine (g)                     8.1               2.4\u003c\/div\u003e\n\u003cdiv\u003eHistidine (g)                   1.2               0.4\u003c\/div\u003e\n\u003cdiv\u003eArginine (g)                    1.8               0.5\u003c\/div\u003e\n\u003cdiv\u003eThreonine (g)                 4.9               1.5\u003c\/div\u003e\n\u003cdiv\u003eAlanine (g)                     5.9               1.8\u003c\/div\u003e\n\u003cdiv\u003eProline (g)                      3.8               1.1\u003c\/div\u003e\n\u003cdiv\u003eTyrosine (g)                    2.0               0.6\u003c\/div\u003e\n\u003cdiv\u003eMethionine (g)                1.2               0.4\u003c\/div\u003e\n\u003cdiv\u003eCystine (g)                     1.6               0.5\u003c\/div\u003e\n\u003cdiv\u003ePhenylalanine (g)           2.2              0.6\u003c\/div\u003e\n\u003cdiv\u003eLysine (g)                       11.3             3.4\u003c\/div\u003e\n\u003cdiv\u003eTryptophan (g)                0.9              0.3\u003c\/div\u003e\n\u003cdiv\u003eTotal                                81.7            25\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003c\/span\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003c\/span\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003c\/span\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eIngredients\u003c\/span\u003e\u003c\/strong\u003e\u003cbr\u003eWhey Protein Concentrate (Contains Emulsifier: Soya Lecithin) (Milk), Whey Protein Isolate (Milk), Whey Protein Hydrolysate (Milk), Flavouring, Thickener(Cellulose Gum), Digezyme Enzyme Complex (Alpha-Amylase, Neutral Protease, Lactase, Lipase, Cellulase), Sweeteners (Acesulfame Potassium, Sucralose).\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003ePreparation Instructions\u003c\/strong\u003e\u003c\/span\u003e\u003cbr\u003eAdd one scoop to 200ml of cold water in a shaker, fully skimmed milk, nut milk such as almond milk\/coconut milk. Shake well.\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003ch2\u003e\u003c\/h2\u003e"}

Whey Isoblend
Vanilla Ice Cream

£18.20 £26.00

Whey Isoblend

£18.20 £26.00
Who is Isoblend for? Isoblend is for those looking to tone, sculpt and build lean muscle mass. When training, Protein intake is essential to muscle growth and recovery. It can however, be very hard to obtain the correct amount of protein purely through food, which is why supplementing your diet...
Sale 50% off
Grilla FreeStyle Breathable Vest Grilla FreeStyle Breathable Vest
{"id":8782654921,"title":"Grilla FreeStyle Breathable Vest","handle":"grilla-freestyle-breathable-vest-blue","description":"\u003cp\u003eThe Grilla FreeStyle breathable vest is part of our launch collection. The FreeStyle uses a high quality lightweight performance material which provides support yet figure flattering styling. It feels great to the touch, including breathable mesh panelling on the front and back which is arranged to the contours of the body. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Figure enhancing fit\u003cbr\u003e Light Weight yet high quality fabric\u003cbr\u003e Shell: 92% Polyester 8% Elastane \u003cbr\u003e Panel: 92% Polyester 8% Elastane \u003cbr\u003e \u003cbr\u003e Model is 5,6 and wears small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e","published_at":"2017-01-31T14:43:00+00:00","created_at":"2017-01-31T14:43:53+00:00","vendor":"Grilla Clothing","type":"WOMENS","tags":[],"price":700,"price_min":700,"price_max":700,"available":true,"price_varies":false,"compare_at_price":1400,"compare_at_price_min":1400,"compare_at_price_max":1400,"compare_at_price_varies":false,"variants":[{"id":30067865353,"title":"S","option1":"S","option2":null,"option3":null,"sku":"FreeStyleBS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353370185,"product_id":8782654921,"position":1,"created_at":"2017-01-31T14:43:53+00:00","updated_at":"2017-01-31T14:43:53+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestbluefront.jpg?v=1485873833","variant_ids":[30067865353,30067865481,30067865545]},"available":true,"name":"Grilla FreeStyle Breathable Vest - S","public_title":"S","options":["S"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":82,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090550"},{"id":30067865481,"title":"M","option1":"M","option2":null,"option3":null,"sku":"FreeStyleBM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353370185,"product_id":8782654921,"position":1,"created_at":"2017-01-31T14:43:53+00:00","updated_at":"2017-01-31T14:43:53+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestbluefront.jpg?v=1485873833","variant_ids":[30067865353,30067865481,30067865545]},"available":true,"name":"Grilla FreeStyle Breathable Vest - M","public_title":"M","options":["M"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":83,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090567"},{"id":30067865545,"title":"L","option1":"L","option2":null,"option3":null,"sku":"FreeStyleBL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353370185,"product_id":8782654921,"position":1,"created_at":"2017-01-31T14:43:53+00:00","updated_at":"2017-01-31T14:43:53+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestbluefront.jpg?v=1485873833","variant_ids":[30067865353,30067865481,30067865545]},"available":true,"name":"Grilla FreeStyle Breathable Vest - L","public_title":"L","options":["L"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":84,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090574"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestbluefront.jpg?v=1485873833","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestblueback.jpg?v=1485873833"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestbluefront.jpg?v=1485873833","options":["size"],"content":"\u003cp\u003eThe Grilla FreeStyle breathable vest is part of our launch collection. The FreeStyle uses a high quality lightweight performance material which provides support yet figure flattering styling. It feels great to the touch, including breathable mesh panelling on the front and back which is arranged to the contours of the body. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Figure enhancing fit\u003cbr\u003e Light Weight yet high quality fabric\u003cbr\u003e Shell: 92% Polyester 8% Elastane \u003cbr\u003e Panel: 92% Polyester 8% Elastane \u003cbr\u003e \u003cbr\u003e Model is 5,6 and wears small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e"}

Grilla FreeStyle Breathable Vest
Blue

£7.00 £14.00

Grilla FreeStyle Breathable Vest

£7.00 £14.00
The Grilla FreeStyle breathable vest is part of our launch collection. The FreeStyle uses a high quality lightweight performance material which provides support yet figure flattering styling. It feels great to the touch, including breathable mesh panelling on the front and back which is arranged to the contours of the...
Sale 30% off
Whey Isoblend
{"id":1582753546333,"title":"Whey Isoblend","handle":"whey-isoblend-strawberry-swirl","description":"\u003cp\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eWho is Isoblend for?\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eIsoblend is for those looking to tone, sculpt and build lean muscle mass. When training, Protein intake is essential to muscle growth and recovery. It can however, be very hard to obtain the correct amount of protein purely through food, which is why supplementing your diet with Isoblend can greatly improve muscle growth and recovery.  It is suitable for both men and women aiming to support their gym, sport or exercise activities\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003eAround 82% protein\u003c\/li\u003e\n\u003cli\u003eUltra high quality whey isolate content\u003c\/li\u003e\n\u003cli\u003eUltra Low calories, 116 per serving\u003c\/li\u003e\n\u003cli\u003eOnly 1.6g of carbs per serving\u003c\/li\u003e\n\u003cli\u003eWhey protein sourced from grass fed cows\u003c\/li\u003e\n\u003cli\u003eNon GMO\u003c\/li\u003e\n\u003cli\u003eNo added Gluten\u003c\/li\u003e\n\u003cli\u003eVegetarian Friendly\u003c\/li\u003e\n\u003cli\u003eAdded digestive enzymes to help break down nutrients\u003c\/li\u003e\n\u003cli\u003eIncredible taste!\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eNutrition\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003e                                   \u003cspan style=\"text-decoration: underline;\"\u003e\u003cspan\u003e Per 100g    Per 30g Portion   %RI* \u003c\/span\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cdiv\u003eEnergy (kj\/kcal)            1618\/387    485\/116                6% \u003c\/div\u003e\n\u003cdiv\u003eFat (g)                           4.3             1.3                        2% \u003c\/div\u003e\n\u003cdiv\u003eof which saturates (g)   2.7             0.8                        4% \u003c\/div\u003e\n\u003cdiv\u003eCarbohydrate (g)          5.4             1.6                        1% \u003c\/div\u003e\n\u003cdiv\u003eof which sugar (g)         3.5             1.0                        1% \u003c\/div\u003e\n\u003cdiv\u003eFibre (g)                        0.9             0.3 \u003c\/div\u003e\n\u003cdiv\u003eProtein (g)                    81.7            24.5                       49%\u003c\/div\u003e\n\u003cdiv\u003eSalt (g)                         0.4              0.1                         2%\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cdiv\u003e\n\u003cdiv\u003e\n\u003cspan style=\"text-decoration: underline;\"\u003eAmino Acid\u003c\/span\u003e                 \u003cspan style=\"text-decoration: underline;\"\u003ePer 100g      Per 30g\u003c\/span\u003e\n\u003c\/div\u003e\n\u003cdiv\u003eLeucine (g)                    7.0               2.1\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv\u003eIsoleucine (g)                 3.8               1.1\u003c\/div\u003e\n\u003cdiv\u003eValine (g)                       3.8               1.1\u003c\/div\u003e\n\u003cdiv\u003eAspartic Acid (g)            7.2               2.1\u003c\/div\u003e\n\u003cdiv\u003eGlutamic Acid (g)          11.5              3.4\u003c\/div\u003e\n\u003cdiv\u003eSerine (g)                       3.6              1.1\u003c\/div\u003e\n\u003cdiv\u003eGlycine (g)                     8.1               2.4\u003c\/div\u003e\n\u003cdiv\u003eHistidine (g)                   1.2               0.4\u003c\/div\u003e\n\u003cdiv\u003eArginine (g)                    1.8               0.5\u003c\/div\u003e\n\u003cdiv\u003eThreonine (g)                 4.9               1.5\u003c\/div\u003e\n\u003cdiv\u003eAlanine (g)                     5.9               1.8\u003c\/div\u003e\n\u003cdiv\u003eProline (g)                      3.8               1.1\u003c\/div\u003e\n\u003cdiv\u003eTyrosine (g)                    2.0               0.6\u003c\/div\u003e\n\u003cdiv\u003eMethionine (g)                1.2               0.4\u003c\/div\u003e\n\u003cdiv\u003eCystine (g)                     1.6               0.5\u003c\/div\u003e\n\u003cdiv\u003ePhenylalanine (g)           2.2              0.6\u003c\/div\u003e\n\u003cdiv\u003eLysine (g)                       11.3             3.4\u003c\/div\u003e\n\u003cdiv\u003eTryptophan (g)                0.9              0.3\u003c\/div\u003e\n\u003cdiv\u003eTotal                                81.7            25\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003c\/span\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003c\/span\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eIngredients\u003c\/span\u003e\u003c\/strong\u003e\u003cbr\u003eWhey Protein Concentrate (Contains Emulsifier: Soya Lecithin) (Milk), Whey Protein Isolate (Milk), Whey Protein Hydrolysate (Milk), Flavouring, Thickener(Cellulose Gum), Digezyme Enzyme Complex (Alpha-Amylase, Neutral Protease, Lactase, Lipase, Cellulase), Sweeteners (Acesulfame Potassium, Sucralose).\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003ePreparation Instructions\u003c\/strong\u003e\u003c\/span\u003e\u003cbr\u003eAdd one scoop to 200ml of cold water in a shaker, fully skimmed milk, nut milk such as almond milk\/coconut milk. Shake well.\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003ch2\u003e\u003c\/h2\u003e","published_at":"2018-12-05T16:08:51+00:00","created_at":"2018-11-29T14:34:39+00:00","vendor":"Grilla Fitness","type":"","tags":[],"price":1820,"price_min":1820,"price_max":1820,"available":true,"price_varies":false,"compare_at_price":2600,"compare_at_price_min":2600,"compare_at_price_max":2600,"compare_at_price_varies":false,"variants":[{"id":15458458632285,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ISOBLSC","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Whey Isoblend","public_title":null,"options":["Default Title"],"price":1820,"weight":1130,"compare_at_price":2600,"inventory_quantity":281,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090857"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/strawberrywhey.png?v=1564602188"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/strawberrywhey.png?v=1564602188","options":["Title"],"content":"\u003cp\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eWho is Isoblend for?\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eIsoblend is for those looking to tone, sculpt and build lean muscle mass. When training, Protein intake is essential to muscle growth and recovery. It can however, be very hard to obtain the correct amount of protein purely through food, which is why supplementing your diet with Isoblend can greatly improve muscle growth and recovery.  It is suitable for both men and women aiming to support their gym, sport or exercise activities\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003eAround 82% protein\u003c\/li\u003e\n\u003cli\u003eUltra high quality whey isolate content\u003c\/li\u003e\n\u003cli\u003eUltra Low calories, 116 per serving\u003c\/li\u003e\n\u003cli\u003eOnly 1.6g of carbs per serving\u003c\/li\u003e\n\u003cli\u003eWhey protein sourced from grass fed cows\u003c\/li\u003e\n\u003cli\u003eNon GMO\u003c\/li\u003e\n\u003cli\u003eNo added Gluten\u003c\/li\u003e\n\u003cli\u003eVegetarian Friendly\u003c\/li\u003e\n\u003cli\u003eAdded digestive enzymes to help break down nutrients\u003c\/li\u003e\n\u003cli\u003eIncredible taste!\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eNutrition\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003e                                   \u003cspan style=\"text-decoration: underline;\"\u003e\u003cspan\u003e Per 100g    Per 30g Portion   %RI* \u003c\/span\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cdiv\u003eEnergy (kj\/kcal)            1618\/387    485\/116                6% \u003c\/div\u003e\n\u003cdiv\u003eFat (g)                           4.3             1.3                        2% \u003c\/div\u003e\n\u003cdiv\u003eof which saturates (g)   2.7             0.8                        4% \u003c\/div\u003e\n\u003cdiv\u003eCarbohydrate (g)          5.4             1.6                        1% \u003c\/div\u003e\n\u003cdiv\u003eof which sugar (g)         3.5             1.0                        1% \u003c\/div\u003e\n\u003cdiv\u003eFibre (g)                        0.9             0.3 \u003c\/div\u003e\n\u003cdiv\u003eProtein (g)                    81.7            24.5                       49%\u003c\/div\u003e\n\u003cdiv\u003eSalt (g)                         0.4              0.1                         2%\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cdiv\u003e\n\u003cdiv\u003e\n\u003cspan style=\"text-decoration: underline;\"\u003eAmino Acid\u003c\/span\u003e                 \u003cspan style=\"text-decoration: underline;\"\u003ePer 100g      Per 30g\u003c\/span\u003e\n\u003c\/div\u003e\n\u003cdiv\u003eLeucine (g)                    7.0               2.1\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv\u003eIsoleucine (g)                 3.8               1.1\u003c\/div\u003e\n\u003cdiv\u003eValine (g)                       3.8               1.1\u003c\/div\u003e\n\u003cdiv\u003eAspartic Acid (g)            7.2               2.1\u003c\/div\u003e\n\u003cdiv\u003eGlutamic Acid (g)          11.5              3.4\u003c\/div\u003e\n\u003cdiv\u003eSerine (g)                       3.6              1.1\u003c\/div\u003e\n\u003cdiv\u003eGlycine (g)                     8.1               2.4\u003c\/div\u003e\n\u003cdiv\u003eHistidine (g)                   1.2               0.4\u003c\/div\u003e\n\u003cdiv\u003eArginine (g)                    1.8               0.5\u003c\/div\u003e\n\u003cdiv\u003eThreonine (g)                 4.9               1.5\u003c\/div\u003e\n\u003cdiv\u003eAlanine (g)                     5.9               1.8\u003c\/div\u003e\n\u003cdiv\u003eProline (g)                      3.8               1.1\u003c\/div\u003e\n\u003cdiv\u003eTyrosine (g)                    2.0               0.6\u003c\/div\u003e\n\u003cdiv\u003eMethionine (g)                1.2               0.4\u003c\/div\u003e\n\u003cdiv\u003eCystine (g)                     1.6               0.5\u003c\/div\u003e\n\u003cdiv\u003ePhenylalanine (g)           2.2              0.6\u003c\/div\u003e\n\u003cdiv\u003eLysine (g)                       11.3             3.4\u003c\/div\u003e\n\u003cdiv\u003eTryptophan (g)                0.9              0.3\u003c\/div\u003e\n\u003cdiv\u003eTotal                                81.7            25\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003c\/span\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003c\/span\u003e\u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cstrong\u003e\u003cspan style=\"text-decoration: underline;\"\u003eIngredients\u003c\/span\u003e\u003c\/strong\u003e\u003cbr\u003eWhey Protein Concentrate (Contains Emulsifier: Soya Lecithin) (Milk), Whey Protein Isolate (Milk), Whey Protein Hydrolysate (Milk), Flavouring, Thickener(Cellulose Gum), Digezyme Enzyme Complex (Alpha-Amylase, Neutral Protease, Lactase, Lipase, Cellulase), Sweeteners (Acesulfame Potassium, Sucralose).\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003ePreparation Instructions\u003c\/strong\u003e\u003c\/span\u003e\u003cbr\u003eAdd one scoop to 200ml of cold water in a shaker, fully skimmed milk, nut milk such as almond milk\/coconut milk. Shake well.\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003c\/div\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003ch2\u003e\u003c\/h2\u003e"}

Whey Isoblend
Strawberry Swirl

£18.20 £26.00

Whey Isoblend

£18.20 £26.00
Who is Isoblend for? Isoblend is for those looking to tone, sculpt and build lean muscle mass. When training, Protein intake is essential to muscle growth and recovery. It can however, be very hard to obtain the correct amount of protein purely through food, which is why supplementing your diet...
Sale 50% off
Grilla Freeflow Breathable Crew
{"id":8782653897,"title":"Grilla Freeflow Breathable Crew","handle":"grilla-freeflow-breathable-crew-blue","description":"The Grilla Freeflow breathable Crew is part of our launch collection. The Freeflow uses a high quality performance material which provides compression yet allows freedom for explosive movement when called upon. It includes breathable mesh panelling on the back which is arranged to the contours of the back muscles to give a physique enhancing result. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e Compression feel\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears large","published_at":"2017-01-31T14:43:00+00:00","created_at":"2017-01-31T14:43:43+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":1000,"price_min":1000,"price_max":1000,"available":true,"price_varies":false,"compare_at_price":2000,"compare_at_price_min":2000,"compare_at_price_max":2000,"compare_at_price_varies":false,"variants":[{"id":30067860297,"title":"S","option1":"S","option2":null,"option3":null,"sku":"FreeflowBS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353367881,"product_id":8782653897,"position":1,"created_at":"2017-01-31T14:43:43+00:00","updated_at":"2017-01-31T14:43:43+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewbluefront.jpg?v=1485873823","variant_ids":[30067860297,30067860361,30067860425,30067860489]},"available":true,"name":"Grilla Freeflow Breathable Crew - S","public_title":"S","options":["S"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":77,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090581"},{"id":30067860361,"title":"M","option1":"M","option2":null,"option3":null,"sku":"FreeflowBM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353367881,"product_id":8782653897,"position":1,"created_at":"2017-01-31T14:43:43+00:00","updated_at":"2017-01-31T14:43:43+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewbluefront.jpg?v=1485873823","variant_ids":[30067860297,30067860361,30067860425,30067860489]},"available":true,"name":"Grilla Freeflow Breathable Crew - M","public_title":"M","options":["M"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":61,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090598"},{"id":30067860489,"title":"L","option1":"L","option2":null,"option3":null,"sku":"FreeflowBL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353367881,"product_id":8782653897,"position":1,"created_at":"2017-01-31T14:43:43+00:00","updated_at":"2017-01-31T14:43:43+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewbluefront.jpg?v=1485873823","variant_ids":[30067860297,30067860361,30067860425,30067860489]},"available":true,"name":"Grilla Freeflow Breathable Crew - L","public_title":"L","options":["L"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":51,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090611"},{"id":30067860425,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"FreeflowBXL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353367881,"product_id":8782653897,"position":1,"created_at":"2017-01-31T14:43:43+00:00","updated_at":"2017-01-31T14:43:43+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewbluefront.jpg?v=1485873823","variant_ids":[30067860297,30067860361,30067860425,30067860489]},"available":true,"name":"Grilla Freeflow Breathable Crew - XL","public_title":"XL","options":["XL"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":65,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090598"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewbluefront.jpg?v=1485873823"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewbluefront.jpg?v=1485873823","options":["size"],"content":"The Grilla Freeflow breathable Crew is part of our launch collection. The Freeflow uses a high quality performance material which provides compression yet allows freedom for explosive movement when called upon. It includes breathable mesh panelling on the back which is arranged to the contours of the back muscles to give a physique enhancing result. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e Compression feel\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears large"}

Grilla Freeflow Breathable Crew
Blue

£10.00 £20.00

Grilla Freeflow Breathable Crew

£10.00 £20.00
The Grilla Freeflow breathable Crew is part of our launch collection. The Freeflow uses a high quality performance material which provides compression yet allows freedom for explosive movement when called upon. It includes breathable mesh panelling on the back which is arranged to the contours of the back muscles to...
Burn Blend Twin Pack
{"id":50683740169,"title":"Burn Blend Twin Pack","handle":"burn-blend-twin-pack-strawberries-cream-vanilla-velvet","description":"\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003e\u003cspan\u003ePurchase 2 tubs of your \u003c\/span\u003efavourite\u003cspan\u003e Burn Blend flavours with a 10% discount\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eWe bring you 'Burn Blend' our new weight loss support diet shake. Burn Blend contains a combination of arguably the most effective weight loss ingredients available helping you drop body fat whilst satisfying your hunger. Not only a great weight loss product, Burn Blend comes in two amazing flavours so will act as a treat without you having to feel guilty. Burn Blend mixes ultra smooth and can be added as an ingredient to make a variety of treats, drinks and smoothies. The suggested use is using Burn Blend as a meal replacement for breakfast, then following the free diet plan for lunch dinner and snacks. It is also great when used alongside our famous fat burning supplement 'Burn Bullets' as part of our weight loss supplement stack.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eSuitable for Vegetarians\u003c\/span\u003e\u003cbr\u003eIndustry leading\u003cspan\u003e weight loss support blend\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eGreat taste in three amazing flavours\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eA versatile product (you can use it in cooking and smoothies)\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eGreat mixing smooth shakes\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eA filling yet healthy meal replacement\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eAn array of vital amino acids\u003c\/span\u003e\u003cbr\u003e\u003cbr\u003e\u003cbr\u003e\u003cspan\u003eProduct Information\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eeach 35g serving (one scoop) mix with water typically provides\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eTypical Values Per 100g Per 35g Portion\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eEnergy \u003c\/span\u003ekj\u003cspan\u003e\/kcal 1537\/365 538\/128\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eFat (g) 6.4 2.2\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eof which saturates (g) 3.6 1.3\u003c\/span\u003e\u003cbr\u003eCarbohydrates\u003cspan\u003e (g) 7.0 2.5\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eof which sugars (g) 5.1 1.8\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eFibre (g) 9.9 3.5\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eProtein (g) 63.4 22.2\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eSalt (g) 0.4 0.2\u003c\/span\u003e\u003cbr\u003e\u003cbr\u003e\u003cspan\u003eOther Ingredients - Typical Values \u003c\/span\u003e\u003cbr\u003e\u003cspan\u003ePer 100g Per 35g Portion\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eCocoa Extract (mg) 600 210\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eDairy Calcium (mg) 401 140\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eChromium (mcg) 160 56.0\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eCayenne Extract (mg) 10.0 3.5\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eGarcinia Cambogia (mg) 700 245\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eCLA (mg) 600 210\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eAcai Berry (mg) 300 105\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eL-Carnitine (mg) 500 175\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eGuarana Extract(mg) 1156 404\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eInulin (mg) 8000 2800\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eGreen Tea Extract (mg) 400 140\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eCaffeine (mg) 215 75\u003c\/span\u003e\u003cbr\u003e\u003cbr\u003e\u003cspan\u003eAmino Acid Per 100g Per 35g Portion\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eLeucine 6.7 2.3\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eIsoleucine 3.6 1.3\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eValine 3.6 1.3\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eAspartic Acid 6.8 2.4\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eGlutamic Acid\/L-Glutamine 10.8 3.8\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eSerine 3.4 1.2\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eGlycine 1.2 0.4\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eHistidine 1.1 0.4\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eArginine 1.7 0.6\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eThreonine 4.6 1.6\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eAlanine 3.0 1.1\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eProline 3.6 1.3\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eTyrosine 1.9 0.7\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eMethionine 1.1 0.4\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eCystine 1.5 0.5\u003c\/span\u003e\u003c\/p\u003e","published_at":"2017-10-25T13:31:05+01:00","created_at":"2017-10-25T13:31:05+01:00","vendor":"Grilla Fitness","type":"SUPPLEMENTS","tags":[],"price":5958,"price_min":5958,"price_max":5958,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":470978625545,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"BurnBlendBundSV","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Burn Blend Twin Pack","public_title":null,"options":["Default Title"],"price":5958,"weight":2270,"compare_at_price":null,"inventory_quantity":155,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090109"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/strawvan.png?v=1564650869"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/strawvan.png?v=1564650869","options":["Title"],"content":"\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003e\u003cspan\u003ePurchase 2 tubs of your \u003c\/span\u003efavourite\u003cspan\u003e Burn Blend flavours with a 10% discount\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eWe bring you 'Burn Blend' our new weight loss support diet shake. Burn Blend contains a combination of arguably the most effective weight loss ingredients available helping you drop body fat whilst satisfying your hunger. Not only a great weight loss product, Burn Blend comes in two amazing flavours so will act as a treat without you having to feel guilty. Burn Blend mixes ultra smooth and can be added as an ingredient to make a variety of treats, drinks and smoothies. The suggested use is using Burn Blend as a meal replacement for breakfast, then following the free diet plan for lunch dinner and snacks. It is also great when used alongside our famous fat burning supplement 'Burn Bullets' as part of our weight loss supplement stack.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eSuitable for Vegetarians\u003c\/span\u003e\u003cbr\u003eIndustry leading\u003cspan\u003e weight loss support blend\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eGreat taste in three amazing flavours\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eA versatile product (you can use it in cooking and smoothies)\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eGreat mixing smooth shakes\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eA filling yet healthy meal replacement\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eAn array of vital amino acids\u003c\/span\u003e\u003cbr\u003e\u003cbr\u003e\u003cbr\u003e\u003cspan\u003eProduct Information\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eeach 35g serving (one scoop) mix with water typically provides\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eTypical Values Per 100g Per 35g Portion\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eEnergy \u003c\/span\u003ekj\u003cspan\u003e\/kcal 1537\/365 538\/128\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eFat (g) 6.4 2.2\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eof which saturates (g) 3.6 1.3\u003c\/span\u003e\u003cbr\u003eCarbohydrates\u003cspan\u003e (g) 7.0 2.5\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eof which sugars (g) 5.1 1.8\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eFibre (g) 9.9 3.5\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eProtein (g) 63.4 22.2\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eSalt (g) 0.4 0.2\u003c\/span\u003e\u003cbr\u003e\u003cbr\u003e\u003cspan\u003eOther Ingredients - Typical Values \u003c\/span\u003e\u003cbr\u003e\u003cspan\u003ePer 100g Per 35g Portion\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eCocoa Extract (mg) 600 210\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eDairy Calcium (mg) 401 140\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eChromium (mcg) 160 56.0\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eCayenne Extract (mg) 10.0 3.5\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eGarcinia Cambogia (mg) 700 245\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eCLA (mg) 600 210\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eAcai Berry (mg) 300 105\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eL-Carnitine (mg) 500 175\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eGuarana Extract(mg) 1156 404\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eInulin (mg) 8000 2800\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eGreen Tea Extract (mg) 400 140\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eCaffeine (mg) 215 75\u003c\/span\u003e\u003cbr\u003e\u003cbr\u003e\u003cspan\u003eAmino Acid Per 100g Per 35g Portion\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eLeucine 6.7 2.3\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eIsoleucine 3.6 1.3\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eValine 3.6 1.3\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eAspartic Acid 6.8 2.4\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eGlutamic Acid\/L-Glutamine 10.8 3.8\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eSerine 3.4 1.2\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eGlycine 1.2 0.4\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eHistidine 1.1 0.4\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eArginine 1.7 0.6\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eThreonine 4.6 1.6\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eAlanine 3.0 1.1\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eProline 3.6 1.3\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eTyrosine 1.9 0.7\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eMethionine 1.1 0.4\u003c\/span\u003e\u003cbr\u003e\u003cspan\u003eCystine 1.5 0.5\u003c\/span\u003e\u003c\/p\u003e"}

Burn Blend Twin Pack
Strawberries & Cream/Vanilla Velvet

£59.58

Burn Blend Twin Pack

£59.58
Purchase 2 tubs of your favourite Burn Blend flavours with a 10% discount We bring you 'Burn Blend' our new weight loss support diet shake. Burn Blend contains a combination of arguably the most effective weight loss ingredients available helping you drop body fat whilst satisfying your hunger. Not only a great weight loss...