Products

Grilla Burn Bullets
{"id":8782622857,"title":"Grilla Burn Bullets","handle":"grilla-burn-bullets","description":"\u003c!-- Created with Shogun. --\u003e\n\n\u003cdiv class=\"shogun-root\" data-shogun-id=\"5a4e5577a79cc0003b1f0db8\" data-shogun-site-id=\"594a632b-8f27-4fa6-bc19-96f7d437e854\" data-shogun-page-id=\"5a4e5577a79cc0003b1f0db8\" data-shogun-page-version-id=\"5d569c65267e1f000466f8c2\" data-shogun-platform-type=\"shopify\" data-shogun-variant-id=\"5d569c6a267e1f000466fe06\" data-region=\"main\"\u003e\n \n\u003cscript type=\"text\/javascript\" src=\"https:\/\/lib.getshogun.com\/lazysizes\/2.0.0\/shogun-lazysizes.js\" async\u003e\u003c\/script\u003e\n\n\u003cdiv id=\"s-cb1114db-270c-4f83-a43d-674182de93ad\" class=\"shg-c \"\u003e\n \u003cdiv class=\"shg-rich-text shg-theme-text-content\"\u003e\u003cp\u003e\u003cspan class=\"s1\" style=\"font-family: Avenir;\"\u003eFire up your metabolism with Grilla Burn Bullets. With thousands of happy customers who have experienced amazing body transformations, Burn Bullets boost your metabolism to ensure it is firing right to aid your weight loss. With added green tea and caffeine, the Burn Bullets also help boost concentration, alertness, and energy whilst working out.\u003cbr\u003e\u003c\/span\u003e\u003c\/p\u003e\u003c\/div\u003e\n\n\u003c\/div\u003e\n\n\n\u003c\/div\u003e\n","published_at":"2017-01-31T14:37:00+00:00","created_at":"2017-01-31T14:38:02+00:00","vendor":"Grilla Fitness","type":"SUPPLEMENTS","tags":["Fat Burners and Weight Loss","Grilla","Kirk10bb","Shop By Brand G - L","Shop By Category A - G","top 5 Fat Burning Pills","Top 5 Lean Protein Powders","Weight Loss"],"price":2999,"price_min":2999,"price_max":2999,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":30067632777,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"GRILLABBB","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Grilla Burn Bullets","public_title":null,"options":["Default Title"],"price":2999,"weight":70,"compare_at_price":null,"inventory_quantity":4658,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090796"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/BurnBullets1.png?v=1564598292"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/BurnBullets1.png?v=1564598292","options":["Title"],"content":"\u003c!-- Created with Shogun. --\u003e\n\n\u003cdiv class=\"shogun-root\" data-shogun-id=\"5a4e5577a79cc0003b1f0db8\" data-shogun-site-id=\"594a632b-8f27-4fa6-bc19-96f7d437e854\" data-shogun-page-id=\"5a4e5577a79cc0003b1f0db8\" data-shogun-page-version-id=\"5d569c65267e1f000466f8c2\" data-shogun-platform-type=\"shopify\" data-shogun-variant-id=\"5d569c6a267e1f000466fe06\" data-region=\"main\"\u003e\n \n\u003cscript type=\"text\/javascript\" src=\"https:\/\/lib.getshogun.com\/lazysizes\/2.0.0\/shogun-lazysizes.js\" async\u003e\u003c\/script\u003e\n\n\u003cdiv id=\"s-cb1114db-270c-4f83-a43d-674182de93ad\" class=\"shg-c \"\u003e\n \u003cdiv class=\"shg-rich-text shg-theme-text-content\"\u003e\u003cp\u003e\u003cspan class=\"s1\" style=\"font-family: Avenir;\"\u003eFire up your metabolism with Grilla Burn Bullets. With thousands of happy customers who have experienced amazing body transformations, Burn Bullets boost your metabolism to ensure it is firing right to aid your weight loss. With added green tea and caffeine, the Burn Bullets also help boost concentration, alertness, and energy whilst working out.\u003cbr\u003e\u003c\/span\u003e\u003c\/p\u003e\u003c\/div\u003e\n\n\u003c\/div\u003e\n\n\n\u003c\/div\u003e\n"}

Grilla Burn Bullets

£29.99
Fire up your metabolism with Grilla Burn Bullets. With thousands of happy customers who have experienced amazing body transformations, Burn Bullets boost your metabolism to ensure it is firing right to aid your weight loss. With added green tea and caffeine, the Burn Bullets also help boost concentration, alertness, and...
Grilla Burn Bullets Twin Pack
{"id":8782638985,"title":"Grilla Burn Bullets Twin Pack","handle":"grilla-burn-bullets-twin-pack","description":"\u003c!-- Created with Shogun. --\u003e\n\n\u003cdiv class=\"shogun-root\" data-shogun-id=\"5a514163fb3d4900444cec03\" data-shogun-site-id=\"594a632b-8f27-4fa6-bc19-96f7d437e854\" data-shogun-page-id=\"5a514163fb3d4900444cec03\" data-shogun-page-version-id=\"5d556d00b4182e0052dd4249\" data-shogun-platform-type=\"shopify\" data-shogun-variant-id=\"5d556d01b4182e0052dd44a1\" data-region=\"main\"\u003e\n \n\n\u003cdiv id=\"s-d6ff599e-bf01-47fb-afb4-b5ce43cc49d2\" class=\"shg-c \"\u003e\n \u003cdiv class=\"shg-rich-text shg-theme-text-content\"\u003e\u003cp\u003e\u003cspan class=\"s1\" style=\"font-family: Avenir;\"\u003eFire up your metabolism with Grilla Burn Bullets. With thousands of happy customers who have experienced amazing body transformations, Burn Bullets boost your metabolism to ensure it is firing right to aid your weight loss. With added green tea and caffeine, the Burn Bullets also help boost concentration, alertness, and energy whilst working out.\u003c\/span\u003e\u003c\/p\u003e\u003c\/div\u003e\n\n\u003c\/div\u003e\n\n\u003cdiv id=\"s-a25ddaed-10ba-4c73-81ca-b9a830eb9550\" class=\"shg-c \"\u003e\n \u003cdiv class=\"GFproduct-swatches GFproduct-swatches-1234\"\u003e\n \u003cmeta http-equiv=\"Cache-control\" content=\"public\"\u003e\n\n \u003cdiv\u003e\u003c\/div\u003e\n \u003cul class=\"GFproduct-swatches-ul\"\u003e\n \n \u003c\/ul\u003e\n\n \u003cdiv style=\"clear:both;\"\u003e\u003c\/div\u003e\n\n\u003c\/div\u003e\n\u003c\/div\u003e\n\n\n\u003c\/div\u003e\n","published_at":"2017-01-31T14:40:00+00:00","created_at":"2017-01-31T14:41:04+00:00","vendor":"Grilla Fitness","type":"SUPPLEMENTS","tags":["Fat Burners and Weight Loss","Grilla","Shop By Brand G - L","Shop By Category A - G","top 5 Fat Burning Pills","Top 5 Lean Protein Powders","Weight Loss"],"price":5399,"price_min":5399,"price_max":5399,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":30067757897,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"GrillaBBB2","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Grilla Burn Bullets Twin Pack","public_title":null,"options":["Default Title"],"price":5399,"weight":140,"compare_at_price":null,"inventory_quantity":2329,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090789"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/BurnBullets2n.png?v=1564597866"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/BurnBullets2n.png?v=1564597866","options":["Title"],"content":"\u003c!-- Created with Shogun. --\u003e\n\n\u003cdiv class=\"shogun-root\" data-shogun-id=\"5a514163fb3d4900444cec03\" data-shogun-site-id=\"594a632b-8f27-4fa6-bc19-96f7d437e854\" data-shogun-page-id=\"5a514163fb3d4900444cec03\" data-shogun-page-version-id=\"5d556d00b4182e0052dd4249\" data-shogun-platform-type=\"shopify\" data-shogun-variant-id=\"5d556d01b4182e0052dd44a1\" data-region=\"main\"\u003e\n \n\n\u003cdiv id=\"s-d6ff599e-bf01-47fb-afb4-b5ce43cc49d2\" class=\"shg-c \"\u003e\n \u003cdiv class=\"shg-rich-text shg-theme-text-content\"\u003e\u003cp\u003e\u003cspan class=\"s1\" style=\"font-family: Avenir;\"\u003eFire up your metabolism with Grilla Burn Bullets. With thousands of happy customers who have experienced amazing body transformations, Burn Bullets boost your metabolism to ensure it is firing right to aid your weight loss. With added green tea and caffeine, the Burn Bullets also help boost concentration, alertness, and energy whilst working out.\u003c\/span\u003e\u003c\/p\u003e\u003c\/div\u003e\n\n\u003c\/div\u003e\n\n\u003cdiv id=\"s-a25ddaed-10ba-4c73-81ca-b9a830eb9550\" class=\"shg-c \"\u003e\n \u003cdiv class=\"GFproduct-swatches GFproduct-swatches-1234\"\u003e\n \u003cmeta http-equiv=\"Cache-control\" content=\"public\"\u003e\n\n \u003cdiv\u003e\u003c\/div\u003e\n \u003cul class=\"GFproduct-swatches-ul\"\u003e\n \n \u003c\/ul\u003e\n\n \u003cdiv style=\"clear:both;\"\u003e\u003c\/div\u003e\n\n\u003c\/div\u003e\n\u003c\/div\u003e\n\n\n\u003c\/div\u003e\n"}

Grilla Burn Bullets Twin Pack

£53.99
Fire up your metabolism with Grilla Burn Bullets. With thousands of happy customers who have experienced amazing body transformations, Burn Bullets boost your metabolism to ensure it is firing right to aid your weight loss. With added green tea and caffeine, the Burn Bullets also help boost concentration, alertness, and...
Grilla Burn Bullets Triple Pack
{"id":8782641481,"title":"Grilla Burn Bullets Triple Pack","handle":"grilla-burn-bullets-triple-pack","description":"\u003c!-- Created with Shogun. --\u003e\n\n\u003cdiv class=\"shogun-root\" data-shogun-id=\"5a514235ac94450055bcbaa7\" data-shogun-site-id=\"594a632b-8f27-4fa6-bc19-96f7d437e854\" data-shogun-page-id=\"5a514235ac94450055bcbaa7\" data-shogun-page-version-id=\"5d55707cbed771004f7967e0\" data-shogun-platform-type=\"shopify\" data-shogun-variant-id=\"5d55707cbed771004f796a36\" data-region=\"main\"\u003e\n \n\u003cscript type=\"text\/javascript\" src=\"https:\/\/lib.getshogun.com\/lazysizes\/2.0.0\/shogun-lazysizes.js\" async\u003e\u003c\/script\u003e\n\n\u003cdiv id=\"s-67327da7-ea36-427d-9b16-e053c10f8df0\" class=\"shg-c \"\u003e\n \u003cdiv class=\"shg-rich-text shg-theme-text-content\"\u003e\u003cp\u003eFire up your metabolism with Grilla Burn Bullets. With thousands of happy customers who have experienced amazing body transformations, Burn Bullets boost your metabolism to ensure it is firing right to aid your weight loss. With added green tea and caffeine, the Burn Bullets also help boost concentration, alertness, and energy whilst working out.\u003c\/p\u003e\u003c\/div\u003e\n\n\u003c\/div\u003e\n\n\n\u003c\/div\u003e\n","published_at":"2017-01-31T14:41:00+00:00","created_at":"2017-01-31T14:41:33+00:00","vendor":"Grilla Fitness","type":"SUPPLEMENTS","tags":["Fat Burners and Weight Loss","Grilla","Shop By Brand G - L","Shop By Category A - G","top 5 Fat Burning Pills","Top 5 Lean Protein Powders","Weight Loss"],"price":7649,"price_min":7649,"price_max":7649,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":30067781513,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"GrillaBBB3","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Grilla Burn Bullets Triple Pack","public_title":null,"options":["Default Title"],"price":7649,"weight":210,"compare_at_price":null,"inventory_quantity":1552,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090772"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/BurnBullets3.png?v=1564597976"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/BurnBullets3.png?v=1564597976","options":["Title"],"content":"\u003c!-- Created with Shogun. --\u003e\n\n\u003cdiv class=\"shogun-root\" data-shogun-id=\"5a514235ac94450055bcbaa7\" data-shogun-site-id=\"594a632b-8f27-4fa6-bc19-96f7d437e854\" data-shogun-page-id=\"5a514235ac94450055bcbaa7\" data-shogun-page-version-id=\"5d55707cbed771004f7967e0\" data-shogun-platform-type=\"shopify\" data-shogun-variant-id=\"5d55707cbed771004f796a36\" data-region=\"main\"\u003e\n \n\u003cscript type=\"text\/javascript\" src=\"https:\/\/lib.getshogun.com\/lazysizes\/2.0.0\/shogun-lazysizes.js\" async\u003e\u003c\/script\u003e\n\n\u003cdiv id=\"s-67327da7-ea36-427d-9b16-e053c10f8df0\" class=\"shg-c \"\u003e\n \u003cdiv class=\"shg-rich-text shg-theme-text-content\"\u003e\u003cp\u003eFire up your metabolism with Grilla Burn Bullets. With thousands of happy customers who have experienced amazing body transformations, Burn Bullets boost your metabolism to ensure it is firing right to aid your weight loss. With added green tea and caffeine, the Burn Bullets also help boost concentration, alertness, and energy whilst working out.\u003c\/p\u003e\u003c\/div\u003e\n\n\u003c\/div\u003e\n\n\n\u003c\/div\u003e\n"}

Grilla Burn Bullets Triple Pack

£76.49
Fire up your metabolism with Grilla Burn Bullets. With thousands of happy customers who have experienced amazing body transformations, Burn Bullets boost your metabolism to ensure it is firing right to aid your weight loss. With added green tea and caffeine, the Burn Bullets also help boost concentration, alertness, and...
Target Zone CLA
{"id":8782648329,"title":"Target Zone CLA","handle":"grilla-fitness-target-zone-cla","description":"What Is CLA\u003cbr\u003e Conjugated Linoleic Acid (CLA) is present as a natural compound in meat and dairy products and is associated with fat loss. Conjugated Linoleic Acid is a general term for a mixture of conjugated dienoic isomers of Linoleic acid (C18:2 n-6). Several positional isomers can be distinguished. However, the two predominant isomers are c9, trans 11 and trans 10, c12. CLA is present as a natural compound in meat and dairy products.\u003cbr\u003e\u003cbr\u003e How Does CLA work?\u003cbr\u003e CLA works by reducing body fat by preventing fat accumulation in fat cells. CLA is found in the diet, but diet alone will not provide enough CLA to experience health benefits. To reach an optimal dosage of CLA, a person can supplement his diet with capsules, bars or ready-to-drink shakes fortified with CLA.\u003cbr\u003e\u003cbr\u003e What does CLA do to reduce body fat?\u003cbr\u003e CLA inhibits the activity of the enzyme lipoprotein lipase (LPL). This enzyme transfers fats from the bloodstream to the fat cells. As a result of the decreased enzyme activity the transport of fat into fat cells is blocked. At the same time CLA also stimulates the breakdown of stored body fat (lipolysis). Additional studies have shown that CLA increases the disintegration of cells (apoptosis), resulting in a decreased number of existing fat cells.\u003cbr\u003e\u003cbr\u003e What does CLA do to increase muscle mass?\u003cbr\u003e CLA increases the activity of the enzyme carnitine palmitoyltransferase (CPT). CPT is present in the skeletal muscles and is responsible for the transport of fatty acids into the mitochondria. Energy production in the body takes place in the mitochondria. Fat can be used as fuel for energy production. With an increased activity of CPT in the skeletal muscle, CLA increases the transport of fat into the mitochondria. All these steps elevate the beta-oxidation, thus helping the body to burn more fat. Physical activity stimulates the fat transport from the bloodstream or the fat cell, to be burned in the muscle cell. With no extra fat coming in to store in the fat cells and increased burning of stored fat, the size of these cells is reduced. Using CLA in combination with a sensible diet and moderate exercise can lead to an improved body shape.\u003cbr\u003e\u003cbr\u003e Also note that you can use CLA along side our famous Burn Bullets fat burners they attack the fat using different methods\u003cbr\u003e\u003cbr\u003e Directions for use\u003cbr\u003e Take 1-2 soft gels daily do not exceed the recommended amount unless directed by a healthcare professional\u003cbr\u003e\u003cbr\u003e Nutritional information\u003cbr\u003e (per soft gel) Conjugated linoleic Acid 1000mg 80% Ethyl Ester\u003cbr\u003e\u003cbr\u003e Cautions\u003cbr\u003e Not intended for use by persons under the age of 18. Always consult a GP before taking Nutritional Supplements, especially if you are taking medication, have an existing medical condition or are due to undergo surgery. You should not take supplements as a substitute for a varied and balanced diet or healthy lifestyle. Not suitable for vegetarians or vegans. Side-effects are rare but please discontinue use and contact your GP immediately in the event of an adverse reaction.","published_at":"2017-01-31T14:42:00+00:00","created_at":"2017-01-31T14:42:48+00:00","vendor":"Grilla Fitness","type":"SUPPLEMENTS,Featured","tags":["CLA Capsules","Grilla","Shop By Brand G - L","Shop By Category A - G","Weight Loss"],"price":1199,"price_min":1199,"price_max":1199,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":30067826057,"title":"Default","option1":"Default","option2":null,"option3":null,"sku":"GrillaCLA","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Target Zone CLA","public_title":null,"options":["Default"],"price":1199,"weight":150,"compare_at_price":null,"inventory_quantity":303,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090765"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/targetzonecla.png?v=1564599440"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/targetzonecla.png?v=1564599440","options":["Title"],"content":"What Is CLA\u003cbr\u003e Conjugated Linoleic Acid (CLA) is present as a natural compound in meat and dairy products and is associated with fat loss. Conjugated Linoleic Acid is a general term for a mixture of conjugated dienoic isomers of Linoleic acid (C18:2 n-6). Several positional isomers can be distinguished. However, the two predominant isomers are c9, trans 11 and trans 10, c12. CLA is present as a natural compound in meat and dairy products.\u003cbr\u003e\u003cbr\u003e How Does CLA work?\u003cbr\u003e CLA works by reducing body fat by preventing fat accumulation in fat cells. CLA is found in the diet, but diet alone will not provide enough CLA to experience health benefits. To reach an optimal dosage of CLA, a person can supplement his diet with capsules, bars or ready-to-drink shakes fortified with CLA.\u003cbr\u003e\u003cbr\u003e What does CLA do to reduce body fat?\u003cbr\u003e CLA inhibits the activity of the enzyme lipoprotein lipase (LPL). This enzyme transfers fats from the bloodstream to the fat cells. As a result of the decreased enzyme activity the transport of fat into fat cells is blocked. At the same time CLA also stimulates the breakdown of stored body fat (lipolysis). Additional studies have shown that CLA increases the disintegration of cells (apoptosis), resulting in a decreased number of existing fat cells.\u003cbr\u003e\u003cbr\u003e What does CLA do to increase muscle mass?\u003cbr\u003e CLA increases the activity of the enzyme carnitine palmitoyltransferase (CPT). CPT is present in the skeletal muscles and is responsible for the transport of fatty acids into the mitochondria. Energy production in the body takes place in the mitochondria. Fat can be used as fuel for energy production. With an increased activity of CPT in the skeletal muscle, CLA increases the transport of fat into the mitochondria. All these steps elevate the beta-oxidation, thus helping the body to burn more fat. Physical activity stimulates the fat transport from the bloodstream or the fat cell, to be burned in the muscle cell. With no extra fat coming in to store in the fat cells and increased burning of stored fat, the size of these cells is reduced. Using CLA in combination with a sensible diet and moderate exercise can lead to an improved body shape.\u003cbr\u003e\u003cbr\u003e Also note that you can use CLA along side our famous Burn Bullets fat burners they attack the fat using different methods\u003cbr\u003e\u003cbr\u003e Directions for use\u003cbr\u003e Take 1-2 soft gels daily do not exceed the recommended amount unless directed by a healthcare professional\u003cbr\u003e\u003cbr\u003e Nutritional information\u003cbr\u003e (per soft gel) Conjugated linoleic Acid 1000mg 80% Ethyl Ester\u003cbr\u003e\u003cbr\u003e Cautions\u003cbr\u003e Not intended for use by persons under the age of 18. Always consult a GP before taking Nutritional Supplements, especially if you are taking medication, have an existing medical condition or are due to undergo surgery. You should not take supplements as a substitute for a varied and balanced diet or healthy lifestyle. Not suitable for vegetarians or vegans. Side-effects are rare but please discontinue use and contact your GP immediately in the event of an adverse reaction."}

Target Zone CLA

£11.99

Target Zone CLA

£11.99
What Is CLA Conjugated Linoleic Acid (CLA) is present as a natural compound in meat and dairy products and is associated with fat loss. Conjugated Linoleic Acid is a general term for a mixture of conjugated dienoic isomers of Linoleic acid (C18:2 n-6). Several positional isomers can be distinguished. However,...
Protein Shaker Black
{"id":8782650313,"title":"Grilla Fitness Protein Shaker","handle":"grilla-fitness-protein-shaker-black","description":"\u003cp\u003eOur shaker bottle with plastic mixing mesh allows you to mix your protein drinks easily and quickly. At 600ml there are no blenders needed, just add protein powder, add water or milk and shake.\u003c\/p\u003e\n\u003cp\u003eREMEMBER to post your #SHAKERSELFIE @grillafitness to appear on our social media\u003c\/p\u003e","published_at":"2017-01-31T14:43:00+00:00","created_at":"2017-01-31T14:43:08+00:00","vendor":"Grilla Fitness","type":"ACCESSORIES","tags":[],"price":299,"price_min":299,"price_max":299,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":30067834761,"title":"Default","option1":"Default","option2":null,"option3":null,"sku":"GrillaSHBLA","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Grilla Fitness Protein Shaker","public_title":null,"options":["Default"],"price":299,"weight":120,"compare_at_price":null,"inventory_quantity":231,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090758"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillashaker600mlblack.jpg?v=1485873789"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillashaker600mlblack.jpg?v=1485873789","options":["Title"],"content":"\u003cp\u003eOur shaker bottle with plastic mixing mesh allows you to mix your protein drinks easily and quickly. At 600ml there are no blenders needed, just add protein powder, add water or milk and shake.\u003c\/p\u003e\n\u003cp\u003eREMEMBER to post your #SHAKERSELFIE @grillafitness to appear on our social media\u003c\/p\u003e"}

Grilla Fitness Protein Shaker

£2.99
Our shaker bottle with plastic mixing mesh allows you to mix your protein drinks easily and quickly. At 600ml there are no blenders needed, just add protein powder, add water or milk and shake. REMEMBER to post your #SHAKERSELFIE @grillafitness to appear on our social media
Protein Shaker Blue
{"id":8782650889,"title":"Grilla Fitness Protein Shaker","handle":"grilla-fitness-protein-shaker-blue","description":"\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003eOur shaker bottle with plastic mixing mesh allows you to mix your protein drinks easily and quickly. At 600ml there are no blenders needed, just add protein powder, add water or milk and shake.\u003c\/p\u003e\n\u003cp\u003eREMEMBER to post your #SHAKERSELFIE @grillafitness to appear on our social media\u003c\/p\u003e","published_at":"2017-01-31T14:43:00+00:00","created_at":"2017-01-31T14:43:12+00:00","vendor":"Grilla Fitness","type":"ACCESSORIES","tags":[],"price":299,"price_min":299,"price_max":299,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":30067835401,"title":"Default","option1":"Default","option2":null,"option3":null,"sku":"GrillaSHBLU","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Grilla Fitness Protein Shaker","public_title":null,"options":["Default"],"price":299,"weight":120,"compare_at_price":null,"inventory_quantity":330,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090741"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillashaker600mlblue.jpg?v=1485873792"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillashaker600mlblue.jpg?v=1485873792","options":["Title"],"content":"\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003eOur shaker bottle with plastic mixing mesh allows you to mix your protein drinks easily and quickly. At 600ml there are no blenders needed, just add protein powder, add water or milk and shake.\u003c\/p\u003e\n\u003cp\u003eREMEMBER to post your #SHAKERSELFIE @grillafitness to appear on our social media\u003c\/p\u003e"}

Grilla Fitness Protein Shaker

£2.99
Our shaker bottle with plastic mixing mesh allows you to mix your protein drinks easily and quickly. At 600ml there are no blenders needed, just add protein powder, add water or milk and shake. REMEMBER to post your #SHAKERSELFIE @grillafitness to appear on our social media
Sale 50% off
Grilla Cobra Breathable Vest Grilla Cobra Breathable Vest
{"id":8782651785,"title":"Grilla Cobra Breathable Vest","handle":"grilla-cobra-breathable-vest-black","description":"The Grilla Cobra breathable Tank is part of our launch collection. This Tank uses a high quality performance material which is fitted yet allows freedom of movement. It includes a breathable mesh panel on the back which is visually striking as well as cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e 92% Polyester 8% Elastane \u003cbr\u003e Model is 6,4 and wears large","published_at":"2017-01-31T14:43:00+00:00","created_at":"2017-01-31T14:43:19+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":700,"price_min":700,"price_max":700,"available":true,"price_varies":false,"compare_at_price":1400,"compare_at_price_min":1400,"compare_at_price_max":1400,"compare_at_price_varies":false,"variants":[{"id":30067843657,"title":"S","option1":"S","option2":null,"option3":null,"sku":"CobraBS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353361545,"product_id":8782651785,"position":1,"created_at":"2017-01-31T14:43:19+00:00","updated_at":"2017-01-31T14:43:19+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestblackfront.jpg?v=1485873799","variant_ids":[30067843657,30067843721,30067843785,30067843849]},"available":true,"name":"Grilla Cobra Breathable Vest - S","public_title":"S","options":["S"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":17,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090703"},{"id":30067843721,"title":"M","option1":"M","option2":null,"option3":null,"sku":"CobraBM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353361545,"product_id":8782651785,"position":1,"created_at":"2017-01-31T14:43:19+00:00","updated_at":"2017-01-31T14:43:19+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestblackfront.jpg?v=1485873799","variant_ids":[30067843657,30067843721,30067843785,30067843849]},"available":true,"name":"Grilla Cobra Breathable Vest - M","public_title":"M","options":["M"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":27,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090710"},{"id":30067843785,"title":"L","option1":"L","option2":null,"option3":null,"sku":"CobraBL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353361545,"product_id":8782651785,"position":1,"created_at":"2017-01-31T14:43:19+00:00","updated_at":"2017-01-31T14:43:19+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestblackfront.jpg?v=1485873799","variant_ids":[30067843657,30067843721,30067843785,30067843849]},"available":true,"name":"Grilla Cobra Breathable Vest - L","public_title":"L","options":["L"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":26,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090727"},{"id":30067843849,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"CobraBXL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353361545,"product_id":8782651785,"position":1,"created_at":"2017-01-31T14:43:19+00:00","updated_at":"2017-01-31T14:43:19+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestblackfront.jpg?v=1485873799","variant_ids":[30067843657,30067843721,30067843785,30067843849]},"available":true,"name":"Grilla Cobra Breathable Vest - XL","public_title":"XL","options":["XL"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":32,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090734"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestblackfront.jpg?v=1485873799","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestblackback.jpg?v=1485873799","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestblackfrontdetail.jpg?v=1485873799","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestblackbackdetail.jpg?v=1485873799"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestblackfront.jpg?v=1485873799","options":["size"],"content":"The Grilla Cobra breathable Tank is part of our launch collection. This Tank uses a high quality performance material which is fitted yet allows freedom of movement. It includes a breathable mesh panel on the back which is visually striking as well as cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e 92% Polyester 8% Elastane \u003cbr\u003e Model is 6,4 and wears large"}

Grilla Cobra Breathable Vest
Black

£7.00 £14.00

Grilla Cobra Breathable Vest

£7.00 £14.00
The Grilla Cobra breathable Tank is part of our launch collection. This Tank uses a high quality performance material which is fitted yet allows freedom of movement. It includes a breathable mesh panel on the back which is visually striking as well as cooling, promoting increased performance. Key notes Striking...
Sale 50% off
Grilla Cobra Breathable Vest Grilla Cobra Breathable Vest
{"id":8782652489,"title":"Grilla Cobra Breathable Vest","handle":"grilla-cobra-breathable-vest-white","description":"The Grilla Cobra breathable Tank is part of our launch collection. This Tank uses a high quality performance material which is fitted yet allows freedom of movement. It includes a breathable mesh panel on the back which is visually striking as well as cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e 92% Polyester 8% Elastane \u003cbr\u003e Model is 5,11 and wears medium","published_at":"2017-01-31T14:43:00+00:00","created_at":"2017-01-31T14:43:29+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":700,"price_min":700,"price_max":700,"available":true,"price_varies":false,"compare_at_price":1400,"compare_at_price_min":1400,"compare_at_price_max":1400,"compare_at_price_varies":false,"variants":[{"id":30067851785,"title":"S","option1":"S","option2":null,"option3":null,"sku":"CobraWS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353363401,"product_id":8782652489,"position":1,"created_at":"2017-01-31T14:43:29+00:00","updated_at":"2017-01-31T14:43:29+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestwhitefront.jpg?v=1485873809","variant_ids":[30067851785,30067851849,30067851913,30067851977]},"available":true,"name":"Grilla Cobra Breathable Vest - S","public_title":"S","options":["S"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":40,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090666"},{"id":30067851849,"title":"M","option1":"M","option2":null,"option3":null,"sku":"CobraWM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353363401,"product_id":8782652489,"position":1,"created_at":"2017-01-31T14:43:29+00:00","updated_at":"2017-01-31T14:43:29+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestwhitefront.jpg?v=1485873809","variant_ids":[30067851785,30067851849,30067851913,30067851977]},"available":true,"name":"Grilla Cobra Breathable Vest - M","public_title":"M","options":["M"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":28,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090673"},{"id":30067851977,"title":"L","option1":"L","option2":null,"option3":null,"sku":"CobraWL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353363401,"product_id":8782652489,"position":1,"created_at":"2017-01-31T14:43:29+00:00","updated_at":"2017-01-31T14:43:29+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestwhitefront.jpg?v=1485873809","variant_ids":[30067851785,30067851849,30067851913,30067851977]},"available":true,"name":"Grilla Cobra Breathable Vest - L","public_title":"L","options":["L"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":28,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090697"},{"id":30067851913,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"CobraWXL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353363401,"product_id":8782652489,"position":1,"created_at":"2017-01-31T14:43:29+00:00","updated_at":"2017-01-31T14:43:29+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestwhitefront.jpg?v=1485873809","variant_ids":[30067851785,30067851849,30067851913,30067851977]},"available":true,"name":"Grilla Cobra Breathable Vest - XL","public_title":"XL","options":["XL"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":20,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090680"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestwhitefront.jpg?v=1485873809","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestwhiteback.jpg?v=1485873809","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestwhitefrontdetail.jpg?v=1485873809","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestwhitebackdetail.jpg?v=1485873809"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillacobramensvestwhitefront.jpg?v=1485873809","options":["size"],"content":"The Grilla Cobra breathable Tank is part of our launch collection. This Tank uses a high quality performance material which is fitted yet allows freedom of movement. It includes a breathable mesh panel on the back which is visually striking as well as cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e 92% Polyester 8% Elastane \u003cbr\u003e Model is 5,11 and wears medium"}

Grilla Cobra Breathable Vest
White

£7.00 £14.00

Grilla Cobra Breathable Vest

£7.00 £14.00
The Grilla Cobra breathable Tank is part of our launch collection. This Tank uses a high quality performance material which is fitted yet allows freedom of movement. It includes a breathable mesh panel on the back which is visually striking as well as cooling, promoting increased performance. Key notes Striking...
Sale 50% off
Grilla Freeflow Breathable Crew Grilla Freeflow Breathable Crew
{"id":8782653449,"title":"Grilla Freeflow Breathable Crew","handle":"grilla-freeflow-breathable-crew-grey","description":"The Grilla Freeflow breathable Crew is part of our launch collection. The Freeflow uses a high quality performance material which provides compression yet allows freedom for explosive movement when called upon. It includes breathable mesh panelling on the back which is arranged to the contours of the back muscles to give a physique enhancing result. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e Compression feel\u003cbr\u003e \u003cbr\u003e Model is 5,11 and wears medium","published_at":"2017-01-31T14:43:00+00:00","created_at":"2017-01-31T14:43:38+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":1000,"price_min":1000,"price_max":1000,"available":true,"price_varies":false,"compare_at_price":2000,"compare_at_price_min":2000,"compare_at_price_max":2000,"compare_at_price_varies":false,"variants":[{"id":30067859529,"title":"S","option1":"S","option2":null,"option3":null,"sku":"FreeflowGS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353365961,"product_id":8782653449,"position":1,"created_at":"2017-01-31T14:43:38+00:00","updated_at":"2017-01-31T14:43:38+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewfront.jpg?v=1485873818","variant_ids":[30067859529,30067859593,30067859657,30067859721]},"available":true,"name":"Grilla Freeflow Breathable Crew - S","public_title":"S","options":["S"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":350,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090628"},{"id":30067859593,"title":"M","option1":"M","option2":null,"option3":null,"sku":"FreeflowGM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353365961,"product_id":8782653449,"position":1,"created_at":"2017-01-31T14:43:38+00:00","updated_at":"2017-01-31T14:43:38+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewfront.jpg?v=1485873818","variant_ids":[30067859529,30067859593,30067859657,30067859721]},"available":true,"name":"Grilla Freeflow Breathable Crew - M","public_title":"M","options":["M"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":373,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090635"},{"id":30067859657,"title":"L","option1":"L","option2":null,"option3":null,"sku":"FreeflowGL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353365961,"product_id":8782653449,"position":1,"created_at":"2017-01-31T14:43:38+00:00","updated_at":"2017-01-31T14:43:38+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewfront.jpg?v=1485873818","variant_ids":[30067859529,30067859593,30067859657,30067859721]},"available":true,"name":"Grilla Freeflow Breathable Crew - L","public_title":"L","options":["L"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":278,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090642"},{"id":30067859721,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"FreeflowGXL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353365961,"product_id":8782653449,"position":1,"created_at":"2017-01-31T14:43:38+00:00","updated_at":"2017-01-31T14:43:38+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewfront.jpg?v=1485873818","variant_ids":[30067859529,30067859593,30067859657,30067859721]},"available":true,"name":"Grilla Freeflow Breathable Crew - XL","public_title":"XL","options":["XL"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":142,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090659"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewfront.jpg?v=1485873818","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewback.jpg?v=1485873818"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewfront.jpg?v=1485873818","options":["size"],"content":"The Grilla Freeflow breathable Crew is part of our launch collection. The Freeflow uses a high quality performance material which provides compression yet allows freedom for explosive movement when called upon. It includes breathable mesh panelling on the back which is arranged to the contours of the back muscles to give a physique enhancing result. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e Compression feel\u003cbr\u003e \u003cbr\u003e Model is 5,11 and wears medium"}

Grilla Freeflow Breathable Crew
Grey

£10.00 £20.00

Grilla Freeflow Breathable Crew

£10.00 £20.00
The Grilla Freeflow breathable Crew is part of our launch collection. The Freeflow uses a high quality performance material which provides compression yet allows freedom for explosive movement when called upon. It includes breathable mesh panelling on the back which is arranged to the contours of the back muscles to...
Sale 50% off
Grilla Freeflow Breathable Crew
{"id":8782653897,"title":"Grilla Freeflow Breathable Crew","handle":"grilla-freeflow-breathable-crew-blue","description":"The Grilla Freeflow breathable Crew is part of our launch collection. The Freeflow uses a high quality performance material which provides compression yet allows freedom for explosive movement when called upon. It includes breathable mesh panelling on the back which is arranged to the contours of the back muscles to give a physique enhancing result. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e Compression feel\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears large","published_at":"2017-01-31T14:43:00+00:00","created_at":"2017-01-31T14:43:43+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":1000,"price_min":1000,"price_max":1000,"available":true,"price_varies":false,"compare_at_price":2000,"compare_at_price_min":2000,"compare_at_price_max":2000,"compare_at_price_varies":false,"variants":[{"id":30067860297,"title":"S","option1":"S","option2":null,"option3":null,"sku":"FreeflowBS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353367881,"product_id":8782653897,"position":1,"created_at":"2017-01-31T14:43:43+00:00","updated_at":"2017-01-31T14:43:43+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewbluefront.jpg?v=1485873823","variant_ids":[30067860297,30067860361,30067860425,30067860489]},"available":true,"name":"Grilla Freeflow Breathable Crew - S","public_title":"S","options":["S"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":77,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090581"},{"id":30067860361,"title":"M","option1":"M","option2":null,"option3":null,"sku":"FreeflowBM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353367881,"product_id":8782653897,"position":1,"created_at":"2017-01-31T14:43:43+00:00","updated_at":"2017-01-31T14:43:43+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewbluefront.jpg?v=1485873823","variant_ids":[30067860297,30067860361,30067860425,30067860489]},"available":true,"name":"Grilla Freeflow Breathable Crew - M","public_title":"M","options":["M"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":61,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090598"},{"id":30067860489,"title":"L","option1":"L","option2":null,"option3":null,"sku":"FreeflowBL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353367881,"product_id":8782653897,"position":1,"created_at":"2017-01-31T14:43:43+00:00","updated_at":"2017-01-31T14:43:43+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewbluefront.jpg?v=1485873823","variant_ids":[30067860297,30067860361,30067860425,30067860489]},"available":true,"name":"Grilla Freeflow Breathable Crew - L","public_title":"L","options":["L"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":51,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090611"},{"id":30067860425,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"FreeflowBXL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353367881,"product_id":8782653897,"position":1,"created_at":"2017-01-31T14:43:43+00:00","updated_at":"2017-01-31T14:43:43+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewbluefront.jpg?v=1485873823","variant_ids":[30067860297,30067860361,30067860425,30067860489]},"available":true,"name":"Grilla Freeflow Breathable Crew - XL","public_title":"XL","options":["XL"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":66,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090598"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewbluefront.jpg?v=1485873823"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreeflowmenscrewbluefront.jpg?v=1485873823","options":["size"],"content":"The Grilla Freeflow breathable Crew is part of our launch collection. The Freeflow uses a high quality performance material which provides compression yet allows freedom for explosive movement when called upon. It includes breathable mesh panelling on the back which is arranged to the contours of the back muscles to give a physique enhancing result. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Physique enhancing fit\u003cbr\u003e Compression feel\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears large"}

Grilla Freeflow Breathable Crew
Blue

£10.00 £20.00

Grilla Freeflow Breathable Crew

£10.00 £20.00
The Grilla Freeflow breathable Crew is part of our launch collection. The Freeflow uses a high quality performance material which provides compression yet allows freedom for explosive movement when called upon. It includes breathable mesh panelling on the back which is arranged to the contours of the back muscles to...
Sale 50% off
Grilla FreeStyle Breathable Vest Grilla FreeStyle Breathable Vest
{"id":8782654921,"title":"Grilla FreeStyle Breathable Vest","handle":"grilla-freestyle-breathable-vest-blue","description":"\u003cp\u003eThe Grilla FreeStyle breathable vest is part of our launch collection. The FreeStyle uses a high quality lightweight performance material which provides support yet figure flattering styling. It feels great to the touch, including breathable mesh panelling on the front and back which is arranged to the contours of the body. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Figure enhancing fit\u003cbr\u003e Light Weight yet high quality fabric\u003cbr\u003e Shell: 92% Polyester 8% Elastane \u003cbr\u003e Panel: 92% Polyester 8% Elastane \u003cbr\u003e \u003cbr\u003e Model is 5,6 and wears small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e","published_at":"2017-01-31T14:43:00+00:00","created_at":"2017-01-31T14:43:53+00:00","vendor":"Grilla Clothing","type":"WOMENS","tags":[],"price":700,"price_min":700,"price_max":700,"available":true,"price_varies":false,"compare_at_price":1400,"compare_at_price_min":1400,"compare_at_price_max":1400,"compare_at_price_varies":false,"variants":[{"id":30067865353,"title":"S","option1":"S","option2":null,"option3":null,"sku":"FreeStyleBS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353370185,"product_id":8782654921,"position":1,"created_at":"2017-01-31T14:43:53+00:00","updated_at":"2017-01-31T14:43:53+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestbluefront.jpg?v=1485873833","variant_ids":[30067865353,30067865481,30067865545]},"available":true,"name":"Grilla FreeStyle Breathable Vest - S","public_title":"S","options":["S"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":82,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090550"},{"id":30067865481,"title":"M","option1":"M","option2":null,"option3":null,"sku":"FreeStyleBM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353370185,"product_id":8782654921,"position":1,"created_at":"2017-01-31T14:43:53+00:00","updated_at":"2017-01-31T14:43:53+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestbluefront.jpg?v=1485873833","variant_ids":[30067865353,30067865481,30067865545]},"available":true,"name":"Grilla FreeStyle Breathable Vest - M","public_title":"M","options":["M"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":86,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090567"},{"id":30067865545,"title":"L","option1":"L","option2":null,"option3":null,"sku":"FreeStyleBL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353370185,"product_id":8782654921,"position":1,"created_at":"2017-01-31T14:43:53+00:00","updated_at":"2017-01-31T14:43:53+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestbluefront.jpg?v=1485873833","variant_ids":[30067865353,30067865481,30067865545]},"available":true,"name":"Grilla FreeStyle Breathable Vest - L","public_title":"L","options":["L"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":85,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090574"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestbluefront.jpg?v=1485873833","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestblueback.jpg?v=1485873833"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestbluefront.jpg?v=1485873833","options":["size"],"content":"\u003cp\u003eThe Grilla FreeStyle breathable vest is part of our launch collection. The FreeStyle uses a high quality lightweight performance material which provides support yet figure flattering styling. It feels great to the touch, including breathable mesh panelling on the front and back which is arranged to the contours of the body. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Figure enhancing fit\u003cbr\u003e Light Weight yet high quality fabric\u003cbr\u003e Shell: 92% Polyester 8% Elastane \u003cbr\u003e Panel: 92% Polyester 8% Elastane \u003cbr\u003e \u003cbr\u003e Model is 5,6 and wears small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e"}

Grilla FreeStyle Breathable Vest
Blue

£7.00 £14.00

Grilla FreeStyle Breathable Vest

£7.00 £14.00
The Grilla FreeStyle breathable vest is part of our launch collection. The FreeStyle uses a high quality lightweight performance material which provides support yet figure flattering styling. It feels great to the touch, including breathable mesh panelling on the front and back which is arranged to the contours of the...
Sale 50% off
Grilla FreeStyle Breathable Vest Grilla FreeStyle Breathable Vest
{"id":8782655433,"title":"Grilla FreeStyle Breathable Vest","handle":"grilla-freestyle-breathable-vest-pink","description":"\u003cp\u003eThe Grilla FreeStyle breathable vest is part of our launch collection. The FreeStyle uses a high quality lightweight performance material which provides support yet figure flattering styling. It feels great to the touch, including breathable mesh panelling on the front and back which is arranged to the contours of the body. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Figure enhancing fit\u003cbr\u003e Light Weight yet high quality fabric\u003cbr\u003e Shell: 92% Polyester 8% Elastane \u003cbr\u003e Panel: 92% Polyester 8% Elastane\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eModel is 5,6 and wears small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e","published_at":"2017-01-31T14:43:00+00:00","created_at":"2017-01-31T14:44:01+00:00","vendor":"Grilla Clothing","type":"WOMENS","tags":[],"price":700,"price_min":700,"price_max":700,"available":true,"price_varies":false,"compare_at_price":1400,"compare_at_price_min":1400,"compare_at_price_max":1400,"compare_at_price_varies":false,"variants":[{"id":30067867209,"title":"S","option1":"S","option2":null,"option3":null,"sku":"FreeStylePS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353371977,"product_id":8782655433,"position":1,"created_at":"2017-01-31T14:44:02+00:00","updated_at":"2017-01-31T14:44:02+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkfront.jpg?v=1485873842","variant_ids":[30067867209,30067867273,30067867337]},"available":true,"name":"Grilla FreeStyle Breathable Vest - S","public_title":"S","options":["S"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":68,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090529"},{"id":30067867273,"title":"M","option1":"M","option2":null,"option3":null,"sku":"FreeStylePM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353371977,"product_id":8782655433,"position":1,"created_at":"2017-01-31T14:44:02+00:00","updated_at":"2017-01-31T14:44:02+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkfront.jpg?v=1485873842","variant_ids":[30067867209,30067867273,30067867337]},"available":true,"name":"Grilla FreeStyle Breathable Vest - M","public_title":"M","options":["M"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":66,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090536"},{"id":30067867337,"title":"L","option1":"L","option2":null,"option3":null,"sku":"FreeStylePL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353371977,"product_id":8782655433,"position":1,"created_at":"2017-01-31T14:44:02+00:00","updated_at":"2017-01-31T14:44:02+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkfront.jpg?v=1485873842","variant_ids":[30067867209,30067867273,30067867337]},"available":true,"name":"Grilla FreeStyle Breathable Vest - L","public_title":"L","options":["L"],"price":700,"weight":4000,"compare_at_price":1400,"inventory_quantity":70,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090543"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkfront.jpg?v=1485873842","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkback.jpg?v=1485873842","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkside.jpg?v=1485873842"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillafreestyleladiesvestpinkfront.jpg?v=1485873842","options":["size"],"content":"\u003cp\u003eThe Grilla FreeStyle breathable vest is part of our launch collection. The FreeStyle uses a high quality lightweight performance material which provides support yet figure flattering styling. It feels great to the touch, including breathable mesh panelling on the front and back which is arranged to the contours of the body. The breathable panels are cooling, promoting increased performance.\u003cbr\u003e Key notes\u003cbr\u003e Striking design\u003cbr\u003e Breathable\u003cbr\u003e Figure enhancing fit\u003cbr\u003e Light Weight yet high quality fabric\u003cbr\u003e Shell: 92% Polyester 8% Elastane \u003cbr\u003e Panel: 92% Polyester 8% Elastane\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eModel is 5,6 and wears small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e"}

Grilla FreeStyle Breathable Vest
Pink

£7.00 £14.00

Grilla FreeStyle Breathable Vest

£7.00 £14.00
The Grilla FreeStyle breathable vest is part of our launch collection. The FreeStyle uses a high quality lightweight performance material which provides support yet figure flattering styling. It feels great to the touch, including breathable mesh panelling on the front and back which is arranged to the contours of the...
Sale 50% off
Grilla Squad Hoodie
{"id":8782656457,"title":"Grilla Squad Slim Fit Hoodie","handle":"grilla-squad-slim-fit-hoodie-grey-navy","description":"The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical zipped pockets.\u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Zipped Pockets\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL","published_at":"2017-01-31T14:44:00+00:00","created_at":"2017-01-31T14:44:08+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":1350,"price_min":1350,"price_max":1350,"available":true,"price_varies":false,"compare_at_price":2700,"compare_at_price_min":2700,"compare_at_price_max":2700,"compare_at_price_varies":false,"variants":[{"id":30067873353,"title":"S","option1":"S","option2":null,"option3":null,"sku":"SquadHNS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353375433,"product_id":8782656457,"position":1,"created_at":"2017-01-31T14:44:08+00:00","updated_at":"2017-01-31T14:44:09+00:00","alt":"Grilla Squad Hoodie","width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodienavybluefront_1.jpg?v=1485873849","variant_ids":[30067873353,30067873481,30067873609,30067873801]},"available":true,"name":"Grilla Squad Slim Fit Hoodie - S","public_title":"S","options":["S"],"price":1350,"weight":4000,"compare_at_price":2700,"inventory_quantity":57,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090482"},{"id":30067873481,"title":"M","option1":"M","option2":null,"option3":null,"sku":"SquadHNM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353375433,"product_id":8782656457,"position":1,"created_at":"2017-01-31T14:44:08+00:00","updated_at":"2017-01-31T14:44:09+00:00","alt":"Grilla Squad Hoodie","width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodienavybluefront_1.jpg?v=1485873849","variant_ids":[30067873353,30067873481,30067873609,30067873801]},"available":true,"name":"Grilla Squad Slim Fit Hoodie - M","public_title":"M","options":["M"],"price":1350,"weight":4000,"compare_at_price":2700,"inventory_quantity":18,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090499"},{"id":30067873609,"title":"L","option1":"L","option2":null,"option3":null,"sku":"SquadHNL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353375433,"product_id":8782656457,"position":1,"created_at":"2017-01-31T14:44:08+00:00","updated_at":"2017-01-31T14:44:09+00:00","alt":"Grilla Squad Hoodie","width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodienavybluefront_1.jpg?v=1485873849","variant_ids":[30067873353,30067873481,30067873609,30067873801]},"available":true,"name":"Grilla Squad Slim Fit Hoodie - L","public_title":"L","options":["L"],"price":1350,"weight":4000,"compare_at_price":2700,"inventory_quantity":17,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090505"},{"id":30067873801,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"SquadHNXL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353375433,"product_id":8782656457,"position":1,"created_at":"2017-01-31T14:44:08+00:00","updated_at":"2017-01-31T14:44:09+00:00","alt":"Grilla Squad Hoodie","width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodienavybluefront_1.jpg?v=1485873849","variant_ids":[30067873353,30067873481,30067873609,30067873801]},"available":true,"name":"Grilla Squad Slim Fit Hoodie - XL","public_title":"XL","options":["XL"],"price":1350,"weight":4000,"compare_at_price":2700,"inventory_quantity":15,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090512"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodienavybluefront_1.jpg?v=1485873849"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodienavybluefront_1.jpg?v=1485873849","options":["size"],"content":"The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical zipped pockets.\u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Zipped Pockets\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL"}

Grilla Squad Slim Fit Hoodie
Grey/Navy

£13.50 £27.00

Grilla Squad Slim Fit Hoodie

£13.50 £27.00
The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include "Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical...
Sale 50% off
Grilla Squad Slim Fit Hoodie Grilla Squad Slim Fit Hoodie
{"id":8782657417,"title":"Grilla Squad Slim Fit Hoodie","handle":"grilla-squad-slim-fit-hoodie-1","description":"The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical zipped pockets.\u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Zipped Pockets\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e 60% Polyester 35% Cotton 5% Elastane","published_at":"2017-01-31T14:44:14+00:00","created_at":"2017-01-31T14:44:18+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":1350,"price_min":1350,"price_max":1350,"available":true,"price_varies":false,"compare_at_price":2700,"compare_at_price_min":2700,"compare_at_price_max":2700,"compare_at_price_varies":false,"variants":[{"id":30067881673,"title":"S","option1":"S","option2":null,"option3":null,"sku":"SquadHBS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353377033,"product_id":8782657417,"position":1,"created_at":"2017-01-31T14:44:18+00:00","updated_at":"2017-01-31T14:44:18+00:00","alt":"Grilla Squad Slim Fit Hoodie","width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodieblackfront.jpg?v=1485873858","variant_ids":[30067881673,30067881737,30067881801,30067881865]},"available":true,"name":"Grilla Squad Slim Fit Hoodie - S","public_title":"S","options":["S"],"price":1350,"weight":4000,"compare_at_price":2700,"inventory_quantity":30,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090444"},{"id":30067881737,"title":"M","option1":"M","option2":null,"option3":null,"sku":"SquadHBM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353377033,"product_id":8782657417,"position":1,"created_at":"2017-01-31T14:44:18+00:00","updated_at":"2017-01-31T14:44:18+00:00","alt":"Grilla Squad Slim Fit Hoodie","width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodieblackfront.jpg?v=1485873858","variant_ids":[30067881673,30067881737,30067881801,30067881865]},"available":true,"name":"Grilla Squad Slim Fit Hoodie - M","public_title":"M","options":["M"],"price":1350,"weight":4000,"compare_at_price":2700,"inventory_quantity":16,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090451"},{"id":30067881801,"title":"L","option1":"L","option2":null,"option3":null,"sku":"SquadHBL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353377033,"product_id":8782657417,"position":1,"created_at":"2017-01-31T14:44:18+00:00","updated_at":"2017-01-31T14:44:18+00:00","alt":"Grilla Squad Slim Fit Hoodie","width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodieblackfront.jpg?v=1485873858","variant_ids":[30067881673,30067881737,30067881801,30067881865]},"available":true,"name":"Grilla Squad Slim Fit Hoodie - L","public_title":"L","options":["L"],"price":1350,"weight":4000,"compare_at_price":2700,"inventory_quantity":9,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090468"},{"id":30067881865,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"SquadHBXL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353377033,"product_id":8782657417,"position":1,"created_at":"2017-01-31T14:44:18+00:00","updated_at":"2017-01-31T14:44:18+00:00","alt":"Grilla Squad Slim Fit Hoodie","width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodieblackfront.jpg?v=1485873858","variant_ids":[30067881673,30067881737,30067881801,30067881865]},"available":true,"name":"Grilla Squad Slim Fit Hoodie - XL","public_title":"XL","options":["XL"],"price":1350,"weight":4000,"compare_at_price":2700,"inventory_quantity":19,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090475"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodieblackfront.jpg?v=1485873858","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodieblackback.jpg?v=1485873858","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodieblackside.jpg?v=1485873858","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodieblackalternative.jpg?v=1485873858"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenshoodieblackfront.jpg?v=1485873858","options":["size"],"content":"The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical zipped pockets.\u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Zipped Pockets\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e 60% Polyester 35% Cotton 5% Elastane"}

Grilla Squad Slim Fit Hoodie
Black

£13.50 £27.00

Grilla Squad Slim Fit Hoodie

£13.50 £27.00
The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include "Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical...
Sale 50% off
Grilla Squad Slim Fit Bottoms Grilla Squad Slim Fit Bottoms
{"id":8782659529,"title":"Grilla Squad Slim Fit Bottoms","handle":"grilla-squad-slim-fit-bottoms-navy","description":"The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped pocket.\u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Reverse Zip Pocket\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e 60% Polyester 35% Cotton 5% Elastane \u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL","published_at":"2017-01-31T14:44:00+00:00","created_at":"2017-01-31T14:44:25+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":1300,"price_min":1300,"price_max":1300,"available":true,"price_varies":false,"compare_at_price":2600,"compare_at_price_min":2600,"compare_at_price_max":2600,"compare_at_price_varies":false,"variants":[{"id":30067887497,"title":"S","option1":"S","option2":null,"option3":null,"sku":"SquadJNS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353378697,"product_id":8782659529,"position":1,"created_at":"2017-01-31T14:44:25+00:00","updated_at":"2017-01-31T14:44:25+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsnavyfront.jpg?v=1485873865","variant_ids":[30067887497,30067887561,30067887625,30067887689]},"available":true,"name":"Grilla Squad Slim Fit Bottoms - S","public_title":"S","options":["S"],"price":1300,"weight":4000,"compare_at_price":2600,"inventory_quantity":37,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090406"},{"id":30067887561,"title":"M","option1":"M","option2":null,"option3":null,"sku":"SquadJNM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353378697,"product_id":8782659529,"position":1,"created_at":"2017-01-31T14:44:25+00:00","updated_at":"2017-01-31T14:44:25+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsnavyfront.jpg?v=1485873865","variant_ids":[30067887497,30067887561,30067887625,30067887689]},"available":true,"name":"Grilla Squad Slim Fit Bottoms - M","public_title":"M","options":["M"],"price":1300,"weight":4000,"compare_at_price":2600,"inventory_quantity":22,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090413"},{"id":30067887625,"title":"L","option1":"L","option2":null,"option3":null,"sku":"SquadJNL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353378697,"product_id":8782659529,"position":1,"created_at":"2017-01-31T14:44:25+00:00","updated_at":"2017-01-31T14:44:25+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsnavyfront.jpg?v=1485873865","variant_ids":[30067887497,30067887561,30067887625,30067887689]},"available":true,"name":"Grilla Squad Slim Fit Bottoms - L","public_title":"L","options":["L"],"price":1300,"weight":4000,"compare_at_price":2600,"inventory_quantity":24,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090420"},{"id":30067887689,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"SquadJNXL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353378697,"product_id":8782659529,"position":1,"created_at":"2017-01-31T14:44:25+00:00","updated_at":"2017-01-31T14:44:25+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsnavyfront.jpg?v=1485873865","variant_ids":[30067887497,30067887561,30067887625,30067887689]},"available":true,"name":"Grilla Squad Slim Fit Bottoms - XL","public_title":"XL","options":["XL"],"price":1300,"weight":4000,"compare_at_price":2600,"inventory_quantity":14,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090437"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsnavyfront.jpg?v=1485873865","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsnavyback.jpg?v=1485873865"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsnavyfront.jpg?v=1485873865","options":["size"],"content":"The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped pocket.\u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Reverse Zip Pocket\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e 60% Polyester 35% Cotton 5% Elastane \u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL"}

Grilla Squad Slim Fit Bottoms
Navy

£13.00 £26.00

Grilla Squad Slim Fit Bottoms

£13.00 £26.00
The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include "Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped...
Sale 50% off
Grilla Squad Slim Fit Bottoms Grilla Squad Slim Fit Bottoms
{"id":8782660681,"title":"Grilla Squad Slim Fit Bottoms","handle":"grilla-squad-slim-fit-bottoms-black","description":"The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped pocket.\u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Reverse Zip Pocket\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL 60% Polyester 35% Cotton 5% Elastane","published_at":"2017-01-31T14:44:00+00:00","created_at":"2017-01-31T14:44:35+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":1300,"price_min":1300,"price_max":1300,"available":true,"price_varies":false,"compare_at_price":2600,"compare_at_price_min":2600,"compare_at_price_max":2600,"compare_at_price_varies":false,"variants":[{"id":30067896841,"title":"S","option1":"S","option2":null,"option3":null,"sku":"SquadJBS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353382537,"product_id":8782660681,"position":1,"created_at":"2017-01-31T14:44:35+00:00","updated_at":"2017-01-31T14:44:35+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackfront.jpg?v=1485873875","variant_ids":[30067896841,30067897033,30067897161,30067897289]},"available":true,"name":"Grilla Squad Slim Fit Bottoms - S","public_title":"S","options":["S"],"price":1300,"weight":4000,"compare_at_price":2600,"inventory_quantity":24,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090369"},{"id":30067897033,"title":"M","option1":"M","option2":null,"option3":null,"sku":"SquadJBM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353382537,"product_id":8782660681,"position":1,"created_at":"2017-01-31T14:44:35+00:00","updated_at":"2017-01-31T14:44:35+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackfront.jpg?v=1485873875","variant_ids":[30067896841,30067897033,30067897161,30067897289]},"available":true,"name":"Grilla Squad Slim Fit Bottoms - M","public_title":"M","options":["M"],"price":1300,"weight":4000,"compare_at_price":2600,"inventory_quantity":12,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090376"},{"id":30067897161,"title":"L","option1":"L","option2":null,"option3":null,"sku":"SquadJBL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353382537,"product_id":8782660681,"position":1,"created_at":"2017-01-31T14:44:35+00:00","updated_at":"2017-01-31T14:44:35+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackfront.jpg?v=1485873875","variant_ids":[30067896841,30067897033,30067897161,30067897289]},"available":true,"name":"Grilla Squad Slim Fit Bottoms - L","public_title":"L","options":["L"],"price":1300,"weight":4000,"compare_at_price":2600,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090383"},{"id":30067897289,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"SquadJBXL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353382537,"product_id":8782660681,"position":1,"created_at":"2017-01-31T14:44:35+00:00","updated_at":"2017-01-31T14:44:35+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackfront.jpg?v=1485873875","variant_ids":[30067896841,30067897033,30067897161,30067897289]},"available":true,"name":"Grilla Squad Slim Fit Bottoms - XL","public_title":"XL","options":["XL"],"price":1300,"weight":4000,"compare_at_price":2600,"inventory_quantity":11,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090390"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackfront.jpg?v=1485873875","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackback.jpg?v=1485873875","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackalternative.jpg?v=1485873875","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackzip2.jpg?v=1485873875","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackzip.jpg?v=1485873875"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadmenstaperedbottomsblackfront.jpg?v=1485873875","options":["size"],"content":"The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped pocket.\u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Reverse Zip Pocket\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL 60% Polyester 35% Cotton 5% Elastane"}

Grilla Squad Slim Fit Bottoms
Black

£13.00 £26.00

Grilla Squad Slim Fit Bottoms

£13.00 £26.00
The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include "Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped...
Sale 50% off
Grilla Black Out leggings Grilla Black Out leggings
{"id":8782661513,"title":"Grilla Black Out leggings","handle":"grilla-black-out-leggings","description":"\u003cp\u003eOur Black Out Leggings are high waisted and very flattering. These versatile Leggings are a must for your fitness wear collection as they can be worn with most outfits while still looking great. They include a handy rear zipped pocket and some eye catching pink detailing \u003cbr\u003e Key Notes\u003cbr\u003e Great fit\u003cbr\u003e High waisted\u003cbr\u003e Zip Pocket\u003cbr\u003e Body enhancing\u003cbr\u003e Great Design\u003cbr\u003e 92% Polyester 8% Elastane \u003cbr\u003e \u003cbr\u003e Model is 5,6 and wears small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e","published_at":"2017-01-31T14:44:41+00:00","created_at":"2017-01-31T14:44:44+00:00","vendor":"Grilla Clothing","type":"WOMENS","tags":[],"price":900,"price_min":900,"price_max":900,"available":true,"price_varies":false,"compare_at_price":1800,"compare_at_price_min":1800,"compare_at_price_max":1800,"compare_at_price_varies":false,"variants":[{"id":30067902025,"title":"S","option1":"S","option2":null,"option3":null,"sku":"BlackoutS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353386057,"product_id":8782661513,"position":1,"created_at":"2017-01-31T14:44:45+00:00","updated_at":"2017-01-31T14:44:45+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillablackoutleggingspinkfront.jpg?v=1485873885","variant_ids":[30067902025,30067902089,30067902153]},"available":true,"name":"Grilla Black Out leggings - S","public_title":"S","options":["S"],"price":900,"weight":4000,"compare_at_price":1800,"inventory_quantity":26,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090338"},{"id":30067902089,"title":"M","option1":"M","option2":null,"option3":null,"sku":"BlackoutM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353386057,"product_id":8782661513,"position":1,"created_at":"2017-01-31T14:44:45+00:00","updated_at":"2017-01-31T14:44:45+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillablackoutleggingspinkfront.jpg?v=1485873885","variant_ids":[30067902025,30067902089,30067902153]},"available":true,"name":"Grilla Black Out leggings - M","public_title":"M","options":["M"],"price":900,"weight":4000,"compare_at_price":1800,"inventory_quantity":16,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090345"},{"id":30067902153,"title":"L","option1":"L","option2":null,"option3":null,"sku":"BlackoutL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353386057,"product_id":8782661513,"position":1,"created_at":"2017-01-31T14:44:45+00:00","updated_at":"2017-01-31T14:44:45+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillablackoutleggingspinkfront.jpg?v=1485873885","variant_ids":[30067902025,30067902089,30067902153]},"available":true,"name":"Grilla Black Out leggings - L","public_title":"L","options":["L"],"price":900,"weight":4000,"compare_at_price":1800,"inventory_quantity":32,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090352"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillablackoutleggingspinkfront.jpg?v=1485873885","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillablackoutleggingspinkback.jpg?v=1485873885","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillablackoutleggingspinkbackdetail.jpg?v=1485873885","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillablackoutleggingspinkalternative.jpg?v=1485873885"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillablackoutleggingspinkfront.jpg?v=1485873885","options":["size"],"content":"\u003cp\u003eOur Black Out Leggings are high waisted and very flattering. These versatile Leggings are a must for your fitness wear collection as they can be worn with most outfits while still looking great. They include a handy rear zipped pocket and some eye catching pink detailing \u003cbr\u003e Key Notes\u003cbr\u003e Great fit\u003cbr\u003e High waisted\u003cbr\u003e Zip Pocket\u003cbr\u003e Body enhancing\u003cbr\u003e Great Design\u003cbr\u003e 92% Polyester 8% Elastane \u003cbr\u003e \u003cbr\u003e Model is 5,6 and wears small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e"}

Grilla Black Out leggings

£9.00 £18.00

Grilla Black Out leggings

£9.00 £18.00
Our Black Out Leggings are high waisted and very flattering. These versatile Leggings are a must for your fitness wear collection as they can be worn with most outfits while still looking great. They include a handy rear zipped pocket and some eye catching pink detailing Key Notes Great fit...
Sale 50% off
Grilla Pyro Leggings Grilla Pyro Leggings
{"id":8782662601,"title":"Grilla Pyro Leggings","handle":"grilla-pyro-leggings","description":"\u003cp\u003eOur Pryo Leggings are high waisted and very flattering. Make a big statement when you train by wearing these! Our eye catching pyro Leggings are for the bold fitness girls and are certain to gain you many complimentary comments. These high quality, flexible leggings will support you in all the right places. \u003cbr\u003e Key Notes\u003cbr\u003e Great fit\u003cbr\u003e High waisted\u003cbr\u003e Zip Pocket\u003cbr\u003e Body enhancing\u003cbr\u003e Great Design\u003cbr\u003e 92% Polyester 8% Elastane \u003cbr\u003e \u003cbr\u003e Model is 5,6 and wears size small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e","published_at":"2017-01-31T14:44:00+00:00","created_at":"2017-01-31T14:44:54+00:00","vendor":"Grilla Clothing","type":"WOMENS","tags":["Womens Gym Training Apparel"],"price":1000,"price_min":1000,"price_max":1000,"available":true,"price_varies":false,"compare_at_price":2000,"compare_at_price_min":2000,"compare_at_price_max":2000,"compare_at_price_varies":false,"variants":[{"id":30067915593,"title":"S","option1":"S","option2":null,"option3":null,"sku":"PyroS","requires_shipping":true,"taxable":true,"featured_image":{"id":18353390665,"product_id":8782662601,"position":1,"created_at":"2017-01-31T14:44:54+00:00","updated_at":"2017-01-31T14:44:54+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfront.jpg?v=1485873894","variant_ids":[30067915593,30067915657,30067915721]},"available":true,"name":"Grilla Pyro Leggings - S","public_title":"S","options":["S"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":38,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090307"},{"id":30067915657,"title":"M","option1":"M","option2":null,"option3":null,"sku":"PyroM","requires_shipping":true,"taxable":true,"featured_image":{"id":18353390665,"product_id":8782662601,"position":1,"created_at":"2017-01-31T14:44:54+00:00","updated_at":"2017-01-31T14:44:54+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfront.jpg?v=1485873894","variant_ids":[30067915593,30067915657,30067915721]},"available":true,"name":"Grilla Pyro Leggings - M","public_title":"M","options":["M"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":36,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090314"},{"id":30067915721,"title":"L","option1":"L","option2":null,"option3":null,"sku":"PyroL","requires_shipping":true,"taxable":true,"featured_image":{"id":18353390665,"product_id":8782662601,"position":1,"created_at":"2017-01-31T14:44:54+00:00","updated_at":"2017-01-31T14:44:54+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfront.jpg?v=1485873894","variant_ids":[30067915593,30067915657,30067915721]},"available":true,"name":"Grilla Pyro Leggings - L","public_title":"L","options":["L"],"price":1000,"weight":4000,"compare_at_price":2000,"inventory_quantity":52,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090321"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfront.jpg?v=1485873894","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkback.jpg?v=1485873894","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfulllength.jpg?v=1485873894","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfulllengthback.jpg?v=1485873894"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillapyroleggingspinkfront.jpg?v=1485873894","options":["size"],"content":"\u003cp\u003eOur Pryo Leggings are high waisted and very flattering. Make a big statement when you train by wearing these! Our eye catching pyro Leggings are for the bold fitness girls and are certain to gain you many complimentary comments. These high quality, flexible leggings will support you in all the right places. \u003cbr\u003e Key Notes\u003cbr\u003e Great fit\u003cbr\u003e High waisted\u003cbr\u003e Zip Pocket\u003cbr\u003e Body enhancing\u003cbr\u003e Great Design\u003cbr\u003e 92% Polyester 8% Elastane \u003cbr\u003e \u003cbr\u003e Model is 5,6 and wears size small\u003c\/p\u003e\n\u003cp\u003eSize Guide\u003c\/p\u003e\n\u003cp\u003eS - fit sizes 6-10\u003c\/p\u003e\n\u003cp\u003eM - fit sizes 10-14\u003c\/p\u003e\n\u003cp\u003eL - fit sizes 14-16 \u003c\/p\u003e"}

Grilla Pyro Leggings

£10.00 £20.00

Grilla Pyro Leggings

£10.00 £20.00
Our Pryo Leggings are high waisted and very flattering. Make a big statement when you train by wearing these! Our eye catching pyro Leggings are for the bold fitness girls and are certain to gain you many complimentary comments. These high quality, flexible leggings will support you in all the...
Sale 50% off
Grilla Squad Tracksuit
{"id":8782663305,"title":"Grilla Squad Tracksuit","handle":"full-grilla-squad-slim-fit-outfit-grey-navy","description":"The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped pocket.\u003cbr\u003e \u003cbr\u003e \u003cbr\u003e \u003cbr\u003e The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical zipped pockets.\u003cbr\u003e \u003cbr\u003e \u003cbr\u003e \u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Reverse Zip Pocket\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL 60% Polyester 35% Cotton 5% Elastane","published_at":"2017-01-31T14:45:00+00:00","created_at":"2017-01-31T14:45:01+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":2750,"price_min":2750,"price_max":2750,"available":true,"price_varies":false,"compare_at_price":5500,"compare_at_price_min":5500,"compare_at_price_max":5500,"compare_at_price_varies":false,"variants":[{"id":30067916681,"title":"S","option1":"S","option2":null,"option3":null,"sku":"FullSquadN-S","requires_shipping":true,"taxable":false,"featured_image":{"id":18353393097,"product_id":8782663305,"position":1,"created_at":"2017-01-31T14:45:01+00:00","updated_at":"2017-01-31T14:45:01+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitgrey.jpg?v=1485873901","variant_ids":[30067916681,31418462665,31418462729,31418462793]},"available":true,"name":"Grilla Squad Tracksuit - S","public_title":"S","options":["S"],"price":2750,"weight":4000,"compare_at_price":5500,"inventory_quantity":197,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090260"},{"id":31418462665,"title":"M","option1":"M","option2":null,"option3":null,"sku":"FullSquadN-M","requires_shipping":true,"taxable":false,"featured_image":{"id":18353393097,"product_id":8782663305,"position":1,"created_at":"2017-01-31T14:45:01+00:00","updated_at":"2017-01-31T14:45:01+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitgrey.jpg?v=1485873901","variant_ids":[30067916681,31418462665,31418462729,31418462793]},"available":true,"name":"Grilla Squad Tracksuit - M","public_title":"M","options":["M"],"price":2750,"weight":4000,"compare_at_price":5500,"inventory_quantity":193,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090277"},{"id":31418462729,"title":"L","option1":"L","option2":null,"option3":null,"sku":"FullSquadN-L","requires_shipping":true,"taxable":false,"featured_image":{"id":18353393097,"product_id":8782663305,"position":1,"created_at":"2017-01-31T14:45:01+00:00","updated_at":"2017-01-31T14:45:01+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitgrey.jpg?v=1485873901","variant_ids":[30067916681,31418462665,31418462729,31418462793]},"available":true,"name":"Grilla Squad Tracksuit - L","public_title":"L","options":["L"],"price":2750,"weight":4000,"compare_at_price":5500,"inventory_quantity":194,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090284"},{"id":31418462793,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"FullSquadN-XL","requires_shipping":true,"taxable":false,"featured_image":{"id":18353393097,"product_id":8782663305,"position":1,"created_at":"2017-01-31T14:45:01+00:00","updated_at":"2017-01-31T14:45:01+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitgrey.jpg?v=1485873901","variant_ids":[30067916681,31418462665,31418462729,31418462793]},"available":true,"name":"Grilla Squad Tracksuit - XL","public_title":"XL","options":["XL"],"price":2750,"weight":4000,"compare_at_price":5500,"inventory_quantity":196,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090291"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitgrey.jpg?v=1485873901"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitgrey.jpg?v=1485873901","options":["Size"],"content":"The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped pocket.\u003cbr\u003e \u003cbr\u003e \u003cbr\u003e \u003cbr\u003e The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical zipped pockets.\u003cbr\u003e \u003cbr\u003e \u003cbr\u003e \u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Reverse Zip Pocket\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL 60% Polyester 35% Cotton 5% Elastane"}

Grilla Squad Tracksuit
Grey/Navy

£27.50 £55.00

Grilla Squad Tracksuit

£27.50 £55.00
The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include "Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped...
Sale 50% off
Grilla Squad Tracksuit Grilla Squad Tracksuit
{"id":8782663817,"title":"Grilla Squad Tracksuit","handle":"grilla-squad-tracksuit-black","description":"The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped pocket.\u003cbr\u003e \u003cbr\u003e \u003cbr\u003e \u003cbr\u003e The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical zipped pockets.\u003cbr\u003e \u003cbr\u003e \u003cbr\u003e \u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Reverse Zip Pocket\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL 60% Polyester 35% Cotton 5% Elastane","published_at":"2017-01-31T14:45:00+00:00","created_at":"2017-01-31T14:45:06+00:00","vendor":"Grilla Clothing","type":"MENS","tags":[],"price":2750,"price_min":2750,"price_max":2750,"available":true,"price_varies":false,"compare_at_price":5500,"compare_at_price_min":5500,"compare_at_price_max":5500,"compare_at_price_varies":false,"variants":[{"id":30067917385,"title":"S","option1":"S","option2":null,"option3":null,"sku":"FullSquadB-S","requires_shipping":true,"taxable":false,"featured_image":{"id":18353394249,"product_id":8782663817,"position":1,"created_at":"2017-01-31T14:45:06+00:00","updated_at":"2017-01-31T14:45:06+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitblackfront.jpg?v=1485873906","variant_ids":[30067917385,31418543753,31418543817,31418543881]},"available":true,"name":"Grilla Squad Tracksuit - S","public_title":"S","options":["S"],"price":2750,"weight":4000,"compare_at_price":5500,"inventory_quantity":193,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090222"},{"id":31418543753,"title":"M","option1":"M","option2":null,"option3":null,"sku":"FullSquadB-M","requires_shipping":true,"taxable":false,"featured_image":{"id":18353394249,"product_id":8782663817,"position":1,"created_at":"2017-01-31T14:45:06+00:00","updated_at":"2017-01-31T14:45:06+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitblackfront.jpg?v=1485873906","variant_ids":[30067917385,31418543753,31418543817,31418543881]},"available":true,"name":"Grilla Squad Tracksuit - M","public_title":"M","options":["M"],"price":2750,"weight":4000,"compare_at_price":5500,"inventory_quantity":190,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090239"},{"id":31418543817,"title":"L","option1":"L","option2":null,"option3":null,"sku":"FullSquadB-L","requires_shipping":true,"taxable":false,"featured_image":{"id":18353394249,"product_id":8782663817,"position":1,"created_at":"2017-01-31T14:45:06+00:00","updated_at":"2017-01-31T14:45:06+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitblackfront.jpg?v=1485873906","variant_ids":[30067917385,31418543753,31418543817,31418543881]},"available":true,"name":"Grilla Squad Tracksuit - L","public_title":"L","options":["L"],"price":2750,"weight":4000,"compare_at_price":5500,"inventory_quantity":194,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090246"},{"id":31418543881,"title":"XL","option1":"XL","option2":null,"option3":null,"sku":"FullSquadB-XL","requires_shipping":true,"taxable":false,"featured_image":{"id":18353394249,"product_id":8782663817,"position":1,"created_at":"2017-01-31T14:45:06+00:00","updated_at":"2017-01-31T14:45:06+00:00","alt":null,"width":1240,"height":1240,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitblackfront.jpg?v=1485873906","variant_ids":[30067917385,31418543753,31418543817,31418543881]},"available":true,"name":"Grilla Squad Tracksuit - XL","public_title":"XL","options":["XL"],"price":2750,"weight":4000,"compare_at_price":5500,"inventory_quantity":196,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060574090253"}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitblackfront.jpg?v=1485873906","\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitblackback.jpg?v=1485873906"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/1694\/5867\/products\/grillasquadtracksuitblackfront.jpg?v=1485873906","options":["Size"],"content":"The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped pocket.\u003cbr\u003e \u003cbr\u003e \u003cbr\u003e \u003cbr\u003e The Squad Mens Hoodie by Grilla is a slim fit zip front hoodie.The Material composition ensures a great physique enhancing fit that will make you will look great in and out of the gym. We include \"Grilla Blue' subtle detailing giving a great eye-catching features. The Squad Hoodie includes practical zipped pockets.\u003cbr\u003e \u003cbr\u003e \u003cbr\u003e \u003cbr\u003e Key Notes\u003cbr\u003e Slim Fit\u003cbr\u003e Great feel\u003cbr\u003e Reverse Zip Pocket\u003cbr\u003e Physique enhancing\u003cbr\u003e Great Design\u003cbr\u003e \u003cbr\u003e Model is 6,4 and wears XL 60% Polyester 35% Cotton 5% Elastane"}

Grilla Squad Tracksuit
Black

£27.50 £55.00

Grilla Squad Tracksuit

£27.50 £55.00
The Squad Mens bottoms by Grilla are a slim fit design.The Material composition ensures a great physique enhancing fit that will make you look great in and out of the gym. We include "Grilla Blue' subtle detailing giving a great eye-catching features. The Squad bottoms includes a practical reverse zipped...